SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.11.11140 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.11.11140
Domain Number 1 Region: 219-330
Classification Level Classification E-value
Superfamily TPR-like 9.49e-17
Family Tetratricopeptide repeat (TPR) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.11.11140
Sequence length 366
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_11:2653400-2654500(+) | length=366
Sequence
MSTGESAELHEPTMGPIKYVFIPVEETREPKELLFAGGSDEEFRGSITQYFRQKLLSQEQ
KNEMTKHLVQKASESGNRGDDTAPPQVSAQQQNELISEYLEQTSFEIVPIVMPARDNKFV
GTSLYIDDSGRFKDLPLNCRASKIAQRDIRGDAFLLSNHDDPALDEWGRVDCSLSTYNEL
LANPPTTKYDASDRAQMASLTMQRESETKCISEGDVCKAKEAKEAGNKFFTEGDIKAAVQ
AYSECADLTEGRRDLLPNESEVTSLRVSALLNRSLCLYRLGKNDDAAHDARAVLQINAKN
LKAHHHLTKALCGSRDYDEAAKSLEAYEKLGGQPQDIAQIRQSIVEGKKRLMQEEKNKYA
KMFAST
Download sequence
Identical sequences D0A8J4
XP_011780259.1.14543 Tbg972.11.11140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]