SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.11.12320 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.11.12320
Domain Number 1 Region: 2-372
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.28e-112
Family IF2B-like 0.00000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.11.12320
Sequence length 386
Comment | organism=Trypanosoma_brucei_gambiense | product=translation initiation factor 2 subunit, putative | location=Tbg972_11:2915441-2916601(+) | length=386
Sequence
MSSAHNTLESIKYRRGVLQLLDQRRLPLETVYCDITSIDDICCAIKEMRVRGAPAIAVSA
ALALAVVAERELKEQRQNSVWKTADDMRQFLLMSCDKMMSARPTAVNLSKVLIQLKKDIE
TDKANTMEAVLETCVQLAEKIYAADVSFNERIMRHGAAHLLKLASKERVNILTICNTGAL
ATSRYGTALGIVRQLFYEGHLQHLYACETRPWNQGARLTVYECVQENIPCTLICDSAVSA
VMKTHDIDAVVVGADRICKNGDTANKIGTYNLAVAAAYHKVPFFVAAPSTTLDPLTPDGE
GVVIEEREAAEITHIASGGGGLQSDKSNSDYGRKRVVADGPHLKVWNPVFDITPASLITG
GIITENGVFPPATAGPLFDISRIVEP
Download sequence
Identical sequences D0A8W2
XP_011780377.1.14543 Tbg972.11.12320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]