SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.11.13920 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.11.13920
Domain Number 1 Region: 282-551
Classification Level Classification E-value
Superfamily TPR-like 1.2e-27
Family Tetratricopeptide repeat (TPR) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tbg972.11.13920
Sequence length 568
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_11:3295130-3296836(+) | length=568
Sequence
MGARAITLYVLFLSNIFHYLHSLPMAEMTEAPSTGHGNPIEVGSEAPPGIDPMYYALSLL
RRRRLEECVAISSRSLATLVSSGNSAEKKACGQSPNDGHIERTVTRFWSIQMKALAQQNW
FEEIDVDDDGVNDVLLDGEQTVPSNATAVGTSLGGGQPPAAANPGKPPSRMSCGKGTMRP
LSSRCGFARPGTHSARLGSSSMSPVTARLARVGTASLQSVPGGTHLDLQKLDVVKYVQDK
PIVAKLLCDYLLHVAHRPRMVLELCNYILSQEEQRNWWWLSRLGQAHYRLGQLREAEQQF
KSALALQENVMDVLRLAKVFVRMDQPLKALEVLSGASSKNVTDHHLRIAMARLYEELQDK
EKSCDMYRRVLQLDSTNVEAIACIAAHHFYENQQPEVALRLYRRLLQMGVQTTELWNNLG
LCCFYSSQYDIALSCLQRAAAVAPDDESLSDVWFNIGHVGIATGDLSLAERAFRVAVAAN
PQRAEALNNLAVLQLRAGNVEAAYSDITMALAVQPLQLESLYNAALIAYSSGFFEQAYAQ
LQRALDVCPDHPESVGLQAEIRKILAAP
Download sequence
Identical sequences D0A9C2
Tbg972.11.13920 XP_011780537.1.14543 Tb427tmp.01.4290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]