SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.11.16710 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.11.16710
Domain Number 1 Region: 107-141,214-283
Classification Level Classification E-value
Superfamily TPR-like 0.00000579
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.11.16710
Sequence length 324
Comment | organism=Trypanosoma_brucei_gambiense | product=coatomer epsilon subunit, putative | location=Tbg972_11:3913359-3914333(-) | length=324
Sequence
MADPFYDARNALALGNYHQAVAEASGTKTDARKAEDIAAFHAEKEVLLALAQTGLGQGDA
VVAQLKAATCPILVAVREWAVFCSAMKNLSGDIQSDPVICMQLKKLTEAAEVIDPARTQI
AVLAAAALLAVGDNAGALKLSKEWLNDQRHSRENSLLRLHMELRVIVVEALLRMGRTEMA
RSEVKAMEQADEESMLTVLCSGITNLYEGIKTKEAYQTALRRFKELTMSCGQSVLASNLT
ALAQIQLGEYTEAERTLLDVLAMKSGDSDTTANLAVISAHSGKGLDSTGLYTRQAVATSG
PWSRSFSAASAALDAAIEEFTASA
Download sequence
Identical sequences A0A1G4I1V3 D0AA50 Q381U5
Tb11.01.6530 5691.Tb11.01.6530 Tb427tmp.01.6530 gi|74025964|ref|XP_829548.1| Tbg972.11.16710 XP_011780815.1.14543 XP_829548.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]