SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.3.3700 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.3.3700
Domain Number 1 Region: 67-98,399-475
Classification Level Classification E-value
Superfamily TPR-like 0.00001
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.3.3700
Sequence length 483
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_03:858160-859611(+) | length=483
Sequence
MFCVSAARLTALASHQPILPPSVSTRVAVMRFLGDGRSRVPNINTINTLITKTGAKGLAG
NASVLGKAMFYLKRGNPVGAIAEIDKILPEISDDALKRFAVGIRLRARNDLLDMKESALK
VHGGITELEVSDIRAALRDDYKVLEAASPGCWLFELAVAEYRLYEGCAKDAYDSFRLVEK
SIQEYILSLKKPSPSQALHGTDNHASLVLAFQLSRAPPPNVPKVSSKILDEAIKGIVEGY
STKEATLAFKKDLGAALTDEEVVELVYIFEAAHIRHHFHDYFPLHEDYRGWGSERANAAK
GTLASHSTSSVFLDDKLLASIRTSVPHQPFYAGEDELRRFMSSDHKDLIAELRHTFGSGP
KTSLAKSEDAYFDALKAVENSPMSADAAGSAAYPVSQNDICLCLAHQLLYRTRVNIAVAL
TQLDRLEEAVPILDGVINADEYIYMWRALLARGEANKRFGHIGKSDEDFRQLLQLKRITS
ADA
Download sequence
Identical sequences C9ZL20
XP_011772319.1.14543 Tbg972.3.3700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]