SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.5.1520 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.5.1520
Domain Number 1 Region: 332-650
Classification Level Classification E-value
Superfamily TPR-like 2e-94
Family Tetratricopeptide repeat (TPR) 0.00000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tbg972.5.1520
Sequence length 655
Comment | organism=Trypanosoma_brucei_gambiense | product=peroxisome targeting signal 1 receptor, putative | location=Tbg972_05:327972-329939(+) | length=655
Sequence
MDCGAGFALGQQLAKDALHMQGGVRPGTTGNVEQDALMTGMMVPPTGPMEDWAQHFAAHQ
HHHQQHQQMMMQRQHNDALMIQQQHRDMEEAFRASARAGAPQQANAGPLMMPPGPMMMAG
GMAPMMHAGGFMMGGMPQMMPCAPMGMNMGMAPVATMSPATTNTVSGAREGATAVSSAAP
GVVDLGGDSAWAEKLHQAEWGQDYKDVEVHTVEGSTAQTVEEHAKTSKFYEFMDKIRKKE
LLVDEDSGEVVQGPGPDPDVEADTEYLARLAAMEGINVPPSVMDHMQGQDGVQRGTDEDM
EGMMGDDVYDPSADVEQWAQEYAQMQAMQERLQNNTDYPFEANNPYMYHENPMEEGLSML
KLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVH
AALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNLQADVDIDDLNVQSEDFFFAAPN
EYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKL
GATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVG
GTTPTGEASREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSMLL
Download sequence
Identical sequences C9ZNN6 Q9U7C3
Tbg972.5.1520 XP_011773301.1.14543 Tb427.05.1100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]