SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.7.3790 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.7.3790
Domain Number 1 Region: 239-348
Classification Level Classification E-value
Superfamily TPR-like 0.0000169
Family Tetratricopeptide repeat (TPR) 0.0059
Further Details:      
 
Weak hits

Sequence:  Tbg972.7.3790
Domain Number - Region: 22-65
Classification Level Classification E-value
Superfamily GYF domain 0.0214
Family GYF domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tbg972.7.3790
Sequence length 449
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_07:945454-946803(-) | length=449
Sequence
MLFRSVLCKNYQRGGWSPGSKHQKHMTLNPTLYLYRFPGPHGPGPYTMKYWWTLGCFPTG
MEVPFRLHEFLSTYQQEHVPVEVEEWLRCYIKDPLSELVNASNDFFKAVEVYPEVESARG
YKTLQPSIAPLLVPMKKFEEQLGVKISPVGLRSVLSNPVLKDRFLDDLFDYKSYVEKGGS
TPHRRLARSRFEGSLSVLGECEKCLPEQHQVEISESLGTFIGATVSPAETTADDERSLIL
LLTTISEGCINAGNYSDAASVLADALMFCHDPDSQATTHANISFASLLNADFKGAEYNGR
EAALLQPQVKPTSTACARGYVGWAAAAAYQDDFEKAEAIVKDGLTLYVGNEHLEKLANKL
QALREEQPSVYKQVPRSLRESRSHLPSQQSRGLLSGSGKGFSNEFDWVEFKNKLYPSKMD
PRNNEMGSVFRRVGDLGSFISTSRSMERL
Download sequence
Identical sequences C9ZSQ8
XP_011774723.1.14543 Tbg972.7.3790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]