SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.8.2200 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.8.2200
Domain Number 1 Region: 404-435,511-553
Classification Level Classification E-value
Superfamily TPR-like 0.0000165
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.8.2200
Sequence length 653
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_08:606233-608194(+) | length=653
Sequence
MRWIPAVPHVALTTVRSVSNAECVLAINGAGLGLSKRGCISSRSPMFSQRCFYTVGRDGA
VKYRNVVENTLADTPSGYIQDPANYPPQMVTYNKVTPEAQATLDEMERERELMNREELMY
KGCTTKAIQEAKAIIFKGDAAQKEIELACVTLQKSLEELVELLGNTVNKGCSDGVVFLVP
VRKSEEGERSSEEHVVNIDDCNHVRYVIALGKRRLGDFDGSERMCMDILSIDHGSCDALE
CLLEIYTGTAQPVKIRGLLDQLVRWKTEKNTEEQSMEGNAAKITTKLKNNQLELVEVALV
LLSDIIVEAASLYYLEHKEGSTSRYFYEAILPISRALGRQYTSLLLGSLFRCLDEQHLAS
LLRGTTLHESEYTMGLVISFLKMLMACKLFREVDDPLRFEFQILSKLHAALRLSGRKHES
YKICERLIHLYRANSLKYRFSIGNNASEDNVDLLDDLESEYKTALFQYVEDRALDSLVVG
KRLCIQAIEEYPAESAPWETLALIIHKEQPVSGLDDAIVAARKAFSLDPLNLRIILTLAN
FYRAQGRHTLCQAMIDHYKLLKYFIEINASEEDIKATLDDIEKLETDYPIEREPNHVVTQ
FADMKEHMERMEMSHTYSMPIDKEPRVFGAQPVTVPILDPSINVDQPERPRDM
Download sequence
Identical sequences C9ZV34
XP_011775549.1.14543 Tbg972.8.2200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]