SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.8.3990 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.8.3990
Domain Number 1 Region: 370-449
Classification Level Classification E-value
Superfamily TPR-like 0.0000000215
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tbg972.8.3990
Sequence length 466
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_08:1059741-1061141(-) | length=466
Sequence
MWFSHRIRQRGLTPVLVNTLQKRLTCSLTRICLCDCKDASGREGVSSSTSGAVPSRMTSQ
TPPPRPPPTTPAATPGGVQYNTRRESEAVAIEQRRQQQQRATDAQRRGEEPLPEQSESEM
ARWWPEENQNWSGRMFASPLDKNKKKFDGMFVPEMKEVHGPDKPLELSYAGDNFFLNPDF
HMADEVFDETRRFVPPPSFDPAVDEIDDEGFVDGQVMFDIQKAVDEDRRRLEAFGNPLLV
EDQVDYLLQPQREGQENIQQRQEFNGFVHWGLLHGAHMIIEENQDYKKAHEFVNRYMRDI
DLFQKWLEHPKVRAHIQKKFGVDMHAKFDKLMALVMAMYARSKIQVYEDDPAGALKSLTA
CMSFINEGADLKKERHRKAIGAVLAARGMVYCKLKSYDRAEDDLTRALRFVNQKRCATLF
QLRAEAREALGRIEEARLDEERAAEIWENAEVIAPGMSGKPYKFVL
Download sequence
Identical sequences C9ZVL9
Tbg972.8.3990 XP_011775734.1.14543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]