SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.8.4150 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.8.4150
Domain Number 1 Region: 81-124,229-471
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.78e-57
Family IF2B-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.8.4150
Sequence length 475
Comment | organism=Trypanosoma_brucei_gambiense | product=translation initiation factor eif-2b beta subunit, putative,eIF-2B GDP-GTP exchange factor, putative,guanine nucleotide exchange factor subunit GCD2 | location=Tbg972_08:1103650-1105077(-) | length=475
Sequence
MGKRSIRIQEEASPLMEIIGDLIEKFVGNVRRGKLGPRDGKSFSMTAASGSVQLMHEIIT
EFKNHLEKKGTTGTHSHSCEIITSRDVHRLIWLISFTGDAMLRAQFGTLLLTNVTRRVLS
FIRTAAVECKVSSNEVDSFEKGDAGGLDNEKSASLDMQRLATTNRQSSGVCSVAGGTGRG
TGTTNDSNESYEEEEQEISTVGIPGRQTLRRAPSRREVDSVVREEAAVLVHSHDFFNCVL
QHIVELRAEIEGMCDALCERAVKQLHPTDTVITTGSSHTTRRYLLHALSAGTSFKVIILE
GAPLLCEASHKLAAELRSKHAEVQVLPDSSAFAVMGTCTKVLIGAENVLANGGILAPIGT
HPLCIAAKHFAVPVLVVTATIKMTPFYPSDAYCTSLVKISRSSAQEIPWNTYGSPGDVLP
APYGADVDTFGSFVVHSPVTEYVPPELITLYATNESEYTPSQIHRIVRENYSPED
Download sequence
Identical sequences C9ZVN5
XP_011775750.1.14543 Tb427.08.4390 Tbg972.8.4150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]