SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.9.7810 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.9.7810
Domain Number 1 Region: 210-330
Classification Level Classification E-value
Superfamily TPR-like 0.00000000209
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tbg972.9.7810
Sequence length 343
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_09:1668145-1669176(+) | length=343
Sequence
MLRRTLRKRGGFFQNFKSDKNNFFTSLWNKPQTRDERVKSYVPEVIEESLQEQRAVLQEN
TARDVVVELGYKILREIENKRPTPSIAPHLDKILQEYGCKDLIAQRPLSYLLYPCSSMSG
GHQPHELVSNFTENFRELVEEVERSGCSLRVGKRANISKTTRGEATLENVSDHAATLQEA
SSDDKPSDTSKSGPVIMVAKEEHEPMDVTLFIRVVSAMALANVQNGDLSSAVRCVDVCLD
YVVEPSRHGGLLGMKAGILVHQRKFEEAVQCANEAVQVSGNIQGYIHGAFALRMLNRLKE
VVQLLEKGREDHPMNTQIVELIEEARKDLEDKPVVEEPKKITS
Download sequence
Identical sequences C9ZZ56
XP_011776971.1.14543 Tbg972.9.7810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]