SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42527861|ref|NP_972959.1| from Treponema denticola ATCC 35405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42527861|ref|NP_972959.1|
Domain Number 1 Region: 1-330
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.02e-111
Family DAK1 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|42527861|ref|NP_972959.1|
Sequence length 335
Comment dihydroxyacetone kinase [Treponema denticola ATCC 35405]
Sequence
MKKILNRPEEFVDEMVEGILYAYPDKIMPLNGDKRVILNKTKKDNKVGIVTAGGSGHLPV
FLGYVGDGMLDGCAVGNVFASPSANKMYEMIKACNFGKGVLCLYGNYGGDKLNFEMAMSM
AEMDSIQVKEIRVMDDIASSPIETKDKRRGVAGMVFAYKVAGAAAQKGYDLEKLVSVTEK
ALDNIRTMGIALSPCIVPEVGKPTFSIKDDEMEIGMGIHGEVGIEVSKLKTSAEVAKMIF
DKIATEISFSKNDEVAVMINGLGATPMEELFIVYRDLFNILNGLGVKVISPHVGEFATSM
EMAGLSITIMKLDDELKTLLLHDANTPFYTNANKK
Download sequence
Identical sequences A0A0E2E567 A0A0E2EBX1 M2C1F6 M2CVJ3 M2RZS4 Q73K62
243275.TDE2360 NP_972959.1.36654 WP_002674237.1.18616 WP_002674237.1.22144 WP_002674237.1.67935 WP_002674237.1.74579 WP_002674237.1.76680 WP_002674237.1.76838 WP_002674237.1.77933 WP_002674237.1.94299 gi|42527861|ref|NP_972959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]