SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52424487|ref|YP_087624.1| from Mannheimia succiniciproducens MBEL55E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52424487|ref|YP_087624.1|
Domain Number 1 Region: 41-279
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.91e-79
Family Phosphate binding protein-like 0.00000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|52424487|ref|YP_087624.1|
Sequence length 279
Comment NlpA protein [Mannheimia succiniciproducens MBEL55E]
Sequence
MNFKKLLTVAAVTSVFALTACNDEKKADTAAPSAQNTPAQTITVGVMSGPEHQVAEIAAK
VAKEKYNLNVKFVEFNDYALPNPAVSKGDLDINAMQHKPYLDEDVKKNNITNLTIVGNTF
VYPLAGYSKTIKNVSELKEGAKVAVPNDPSNQGRALILLEKQGLIKLKDNTNLAATPLDI
VENPKNLKITPVDTAVAARALDDVDLAVVNNTYAGQVGLNTADNGVFVESKDSPYVNIIV
ARTDNKDSEAVQNFVKAYQTEEVYQEAVKFFKDGVVKGW
Download sequence
Identical sequences Q65VH1
WP_011199614.1.101358 gi|52424487|ref|YP_087624.1| 221988.MS0432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]