SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488652720|ref|YP_007924523.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488652720|ref|YP_007924523.1|
Domain Number 1 Region: 58-469
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.65e-143
Family TK-like PP module 0.000000000000327
Further Details:      
 
Domain Number 2 Region: 474-701
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.41e-98
Family TK-like Pyr module 0.000000000977
Further Details:      
 
Domain Number 3 Region: 702-885
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.07e-64
Family Transketolase C-terminal domain-like 0.0000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488652720|ref|YP_007924523.1|
Sequence length 887
Comment pyruvate dehydrogenase subunit E1 [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEARKGGVKVAAGAGASNY
INTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDV
CFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQEQMDNFRQEVHGNGLSSYPH
PKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESK
GAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIVNELEGIFAGAGWNVIKVMWGGRWD
ELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFGKYPETAALVADWTDEQIWAL
NRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGDTAEGKNIAHQVKKMNMDGVRY
VRDRFNVPVADADLEKLPYITFPEGSEEHKYLHERRQALHGYLPSRQPNFTEKLELPQLS
DFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGASWLAAATSYSTNDLPMIPFYIYY
SMFGFQRIGDLCWQAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPAGAEEGIRKGIYKLETL
EGSKGKVQLLGSGSILRHVREAAEILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHP
LETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEIDKKVVADAITKFNIDADKVNPRLA
Download sequence
Identical sequences A0A0G2NJP0 A0A1R2VWM2 A0A2J0RYG8 A0A2K2P2W6 B5RH90 Q8Z9F0 S4IDU8
209261.t0158 220341.STY0175 550537.SEN0156 550538.SG0154 ABFH02000001|CDS_121166-118503 AE014613|CDS_179378-182041 AL513382|CDS_179387-182050 AM933172|CDS_177651-180314 AM933173|CDS_177803-180466 gi|207855667|ref|YP_002242318.1| gi|205351493|ref|YP_002225294.1| gi|378958303|ref|YP_005215789.1| gi|488652720|ref|YP_007924523.1| gi|29140699|ref|NP_804041.1| gi|16759149|ref|NP_454766.1| NP_454766.1.84458 WP_000003851.1.100008 WP_000003851.1.100036 WP_000003851.1.100077 WP_000003851.1.100079 WP_000003851.1.100149 WP_000003851.1.100191 WP_000003851.1.100196 WP_000003851.1.100284 WP_000003851.1.100313 WP_000003851.1.100314 WP_000003851.1.100321 WP_000003851.1.100354 WP_000003851.1.100392 WP_000003851.1.100412 WP_000003851.1.100421 WP_000003851.1.100446 WP_000003851.1.100450 WP_000003851.1.100457 WP_000003851.1.100519 WP_000003851.1.100541 WP_000003851.1.100557 WP_000003851.1.100592 WP_000003851.1.100605 WP_000003851.1.100610 WP_000003851.1.100650 WP_000003851.1.100732 WP_000003851.1.100733 WP_000003851.1.100739 WP_000003851.1.100764 WP_000003851.1.100776 WP_000003851.1.100799 WP_000003851.1.10081 WP_000003851.1.100857 WP_000003851.1.100941 WP_000003851.1.100953 WP_000003851.1.101011 WP_000003851.1.10108 WP_000003851.1.101112 WP_000003851.1.101185 WP_000003851.1.101226 WP_000003851.1.10124 WP_000003851.1.101271 WP_000003851.1.101312 WP_000003851.1.101322 WP_000003851.1.101374 WP_000003851.1.101541 WP_000003851.1.101616 WP_000003851.1.101634 WP_000003851.1.101674 WP_000003851.1.101832 WP_000003851.1.101890 WP_000003851.1.101917 WP_000003851.1.101941 WP_000003851.1.102050 WP_000003851.1.102087 WP_000003851.1.102111 WP_000003851.1.10300 WP_000003851.1.10338 WP_000003851.1.1038 WP_000003851.1.104 WP_000003851.1.10401 WP_000003851.1.10428 WP_000003851.1.10459 WP_000003851.1.10475 WP_000003851.1.10498 WP_000003851.1.10511 WP_000003851.1.10514 WP_000003851.1.10530 WP_000003851.1.10532 WP_000003851.1.10547 WP_000003851.1.10595 WP_000003851.1.10631 WP_000003851.1.10642 WP_000003851.1.10654 WP_000003851.1.10677 WP_000003851.1.10755 WP_000003851.1.10857 WP_000003851.1.10873 WP_000003851.1.10898 WP_000003851.1.10926 WP_000003851.1.10936 WP_000003851.1.11012 WP_000003851.1.11055 WP_000003851.1.11119 WP_000003851.1.11126 WP_000003851.1.11142 WP_000003851.1.11216 WP_000003851.1.11239 WP_000003851.1.11253 WP_000003851.1.11314 WP_000003851.1.11385 WP_000003851.1.1142 WP_000003851.1.11426 WP_000003851.1.11429 WP_000003851.1.1150 WP_000003851.1.11526 WP_000003851.1.11528 WP_000003851.1.11557 WP_000003851.1.1156 WP_000003851.1.11567 WP_000003851.1.11638 WP_000003851.1.1169 WP_000003851.1.1174 WP_000003851.1.11824 WP_000003851.1.11841 WP_000003851.1.11883 WP_000003851.1.11900 WP_000003851.1.11908 WP_000003851.1.11914 WP_000003851.1.11978 WP_000003851.1.12027 WP_000003851.1.12040 WP_000003851.1.12061 WP_000003851.1.1207 WP_000003851.1.12106 WP_000003851.1.12141 WP_000003851.1.1215 WP_000003851.1.12168 WP_000003851.1.12172 WP_000003851.1.12192 WP_000003851.1.1224 WP_000003851.1.12340 WP_000003851.1.12364 WP_000003851.1.12374 WP_000003851.1.12398 WP_000003851.1.12441 WP_000003851.1.12485 WP_000003851.1.12568 WP_000003851.1.12569 WP_000003851.1.12581 WP_000003851.1.12585 WP_000003851.1.12620 WP_000003851.1.12648 WP_000003851.1.12683 WP_000003851.1.12696 WP_000003851.1.12718 WP_000003851.1.12726 WP_000003851.1.12727 WP_000003851.1.12741 WP_000003851.1.12834 WP_000003851.1.1300 WP_000003851.1.13076 WP_000003851.1.13102 WP_000003851.1.13108 WP_000003851.1.13161 WP_000003851.1.1321 WP_000003851.1.13247 WP_000003851.1.13268 WP_000003851.1.13274 WP_000003851.1.13291 WP_000003851.1.133 WP_000003851.1.13314 WP_000003851.1.13338 WP_000003851.1.13342 WP_000003851.1.13352 WP_000003851.1.13367 WP_000003851.1.13391 WP_000003851.1.13406 WP_000003851.1.13440 WP_000003851.1.13443 WP_000003851.1.1346 WP_000003851.1.13476 WP_000003851.1.13573 WP_000003851.1.13599 WP_000003851.1.13625 WP_000003851.1.13686 WP_000003851.1.1372 WP_000003851.1.13732 WP_000003851.1.1382 WP_000003851.1.1397 WP_000003851.1.13972 WP_000003851.1.140 WP_000003851.1.1401 WP_000003851.1.1408 WP_000003851.1.14089 WP_000003851.1.14099 WP_000003851.1.1412 WP_000003851.1.14120 WP_000003851.1.14123 WP_000003851.1.14150 WP_000003851.1.14191 WP_000003851.1.14197 WP_000003851.1.14280 WP_000003851.1.14333 WP_000003851.1.14399 WP_000003851.1.14444 WP_000003851.1.14467 WP_000003851.1.14474 WP_000003851.1.14500 WP_000003851.1.14526 WP_000003851.1.14550 WP_000003851.1.14575 WP_000003851.1.146 WP_000003851.1.14701 WP_000003851.1.14703 WP_000003851.1.14708 WP_000003851.1.14719 WP_000003851.1.1473 WP_000003851.1.14765 WP_000003851.1.14793 WP_000003851.1.14810 WP_000003851.1.14819 WP_000003851.1.14877 WP_000003851.1.14894 WP_000003851.1.14913 WP_000003851.1.14930 WP_000003851.1.14947 WP_000003851.1.14948 WP_000003851.1.15067 WP_000003851.1.15184 WP_000003851.1.15244 WP_000003851.1.15265 WP_000003851.1.15276 WP_000003851.1.15318 WP_000003851.1.15362 WP_000003851.1.15415 WP_000003851.1.15423 WP_000003851.1.15433 WP_000003851.1.15439 WP_000003851.1.15487 WP_000003851.1.15535 WP_000003851.1.15581 WP_000003851.1.15585 WP_000003851.1.15597 WP_000003851.1.1568 WP_000003851.1.15710 WP_000003851.1.15717 WP_000003851.1.15775 WP_000003851.1.15777 WP_000003851.1.15905 WP_000003851.1.15912 WP_000003851.1.15970 WP_000003851.1.16046 WP_000003851.1.16051 WP_000003851.1.16058 WP_000003851.1.16125 WP_000003851.1.16150 WP_000003851.1.16155 WP_000003851.1.1626 WP_000003851.1.16264 WP_000003851.1.16344 WP_000003851.1.16363 WP_000003851.1.16365 WP_000003851.1.16366 WP_000003851.1.16394 WP_000003851.1.16452 WP_000003851.1.16453 WP_000003851.1.16461 WP_000003851.1.16462 WP_000003851.1.16465 WP_000003851.1.16474 WP_000003851.1.16522 WP_000003851.1.16588 WP_000003851.1.16658 WP_000003851.1.16666 WP_000003851.1.16673 WP_000003851.1.16729 WP_000003851.1.1674 WP_000003851.1.16767 WP_000003851.1.16781 WP_000003851.1.16879 WP_000003851.1.16893 WP_000003851.1.16905 WP_000003851.1.16944 WP_000003851.1.16948 WP_000003851.1.16972 WP_000003851.1.17049 WP_000003851.1.17058 WP_000003851.1.17060 WP_000003851.1.17078 WP_000003851.1.17096 WP_000003851.1.17105 WP_000003851.1.17202 WP_000003851.1.17219 WP_000003851.1.1722 WP_000003851.1.17302 WP_000003851.1.17308 WP_000003851.1.1733 WP_000003851.1.17368 WP_000003851.1.17405 WP_000003851.1.17406 WP_000003851.1.17482 WP_000003851.1.17513 WP_000003851.1.17525 WP_000003851.1.17543 WP_000003851.1.17563 WP_000003851.1.17578 WP_000003851.1.17583 WP_000003851.1.17659 WP_000003851.1.17667 WP_000003851.1.17686 WP_000003851.1.17732 WP_000003851.1.17741 WP_000003851.1.17840 WP_000003851.1.17886 WP_000003851.1.17914 WP_000003851.1.17936 WP_000003851.1.17956 WP_000003851.1.18005 WP_000003851.1.1801 WP_000003851.1.18021 WP_000003851.1.18056 WP_000003851.1.18061 WP_000003851.1.18092 WP_000003851.1.18099 WP_000003851.1.18109 WP_000003851.1.18124 WP_000003851.1.18144 WP_000003851.1.18149 WP_000003851.1.18173 WP_000003851.1.18270 WP_000003851.1.18280 WP_000003851.1.18328 WP_000003851.1.18358 WP_000003851.1.18370 WP_000003851.1.18384 WP_000003851.1.18406 WP_000003851.1.18474 WP_000003851.1.18513 WP_000003851.1.18610 WP_000003851.1.18641 WP_000003851.1.18678 WP_000003851.1.18686 WP_000003851.1.18722 WP_000003851.1.18737 WP_000003851.1.18766 WP_000003851.1.1880 WP_000003851.1.18847 WP_000003851.1.1885 WP_000003851.1.18860 WP_000003851.1.18886 WP_000003851.1.18922 WP_000003851.1.1895 WP_000003851.1.18959 WP_000003851.1.19001 WP_000003851.1.19006 WP_000003851.1.19044 WP_000003851.1.19084 WP_000003851.1.19093 WP_000003851.1.19187 WP_000003851.1.19228 WP_000003851.1.19288 WP_000003851.1.19300 WP_000003851.1.19373 WP_000003851.1.19422 WP_000003851.1.19433 WP_000003851.1.19454 WP_000003851.1.19456 WP_000003851.1.19496 WP_000003851.1.19535 WP_000003851.1.19538 WP_000003851.1.1955 WP_000003851.1.19589 WP_000003851.1.19656 WP_000003851.1.19663 WP_000003851.1.19686 WP_000003851.1.19731 WP_000003851.1.19794 WP_000003851.1.19834 WP_000003851.1.1992 WP_000003851.1.19938 WP_000003851.1.19999 WP_000003851.1.20086 WP_000003851.1.20254 WP_000003851.1.20255 WP_000003851.1.20261 WP_000003851.1.20296 WP_000003851.1.20339 WP_000003851.1.2041 WP_000003851.1.20419 WP_000003851.1.20465 WP_000003851.1.2047 WP_000003851.1.20492 WP_000003851.1.2053 WP_000003851.1.20635 WP_000003851.1.20718 WP_000003851.1.2073 WP_000003851.1.20740 WP_000003851.1.20828 WP_000003851.1.20883 WP_000003851.1.20947 WP_000003851.1.20953 WP_000003851.1.21010 WP_000003851.1.2106 WP_000003851.1.21062 WP_000003851.1.21079 WP_000003851.1.21103 WP_000003851.1.21144 WP_000003851.1.2116 WP_000003851.1.21162 WP_000003851.1.21184 WP_000003851.1.21185 WP_000003851.1.21194 WP_000003851.1.21241 WP_000003851.1.21332 WP_000003851.1.21366 WP_000003851.1.21492 WP_000003851.1.2166 WP_000003851.1.21674 WP_000003851.1.21681 WP_000003851.1.21715 WP_000003851.1.21909 WP_000003851.1.21946 WP_000003851.1.21950 WP_000003851.1.21966 WP_000003851.1.22051 WP_000003851.1.22064 WP_000003851.1.22096 WP_000003851.1.22118 WP_000003851.1.22126 WP_000003851.1.22136 WP_000003851.1.22158 WP_000003851.1.2216 WP_000003851.1.22162 WP_000003851.1.22208 WP_000003851.1.2227 WP_000003851.1.22296 WP_000003851.1.22346 WP_000003851.1.22373 WP_000003851.1.22449 WP_000003851.1.22454 WP_000003851.1.22460 WP_000003851.1.22476 WP_000003851.1.22595 WP_000003851.1.22605 WP_000003851.1.22614 WP_000003851.1.22652 WP_000003851.1.22683 WP_000003851.1.22760 WP_000003851.1.2284 WP_000003851.1.22857 WP_000003851.1.22895 WP_000003851.1.22902 WP_000003851.1.22926 WP_000003851.1.22943 WP_000003851.1.22947 WP_000003851.1.22967 WP_000003851.1.23040 WP_000003851.1.23058 WP_000003851.1.23218 WP_000003851.1.2324 WP_000003851.1.2331 WP_000003851.1.2332 WP_000003851.1.23329 WP_000003851.1.23340 WP_000003851.1.2336 WP_000003851.1.23365 WP_000003851.1.23412 WP_000003851.1.23426 WP_000003851.1.23442 WP_000003851.1.23492 WP_000003851.1.23515 WP_000003851.1.23571 WP_000003851.1.2358 WP_000003851.1.23604 WP_000003851.1.23631 WP_000003851.1.23679 WP_000003851.1.23728 WP_000003851.1.23746 WP_000003851.1.2375 WP_000003851.1.23783 WP_000003851.1.23786 WP_000003851.1.23787 WP_000003851.1.23801 WP_000003851.1.24028 WP_000003851.1.24061 WP_000003851.1.24083 WP_000003851.1.24117 WP_000003851.1.24125 WP_000003851.1.24138 WP_000003851.1.24145 WP_000003851.1.24153 WP_000003851.1.24163 WP_000003851.1.24214 WP_000003851.1.24250 WP_000003851.1.24259 WP_000003851.1.24291 WP_000003851.1.24297 WP_000003851.1.24322 WP_000003851.1.24355 WP_000003851.1.24375 WP_000003851.1.24400 WP_000003851.1.24408 WP_000003851.1.24409 WP_000003851.1.24420 WP_000003851.1.24433 WP_000003851.1.24476 WP_000003851.1.24494 WP_000003851.1.24619 WP_000003851.1.24643 WP_000003851.1.24673 WP_000003851.1.24688 WP_000003851.1.24716 WP_000003851.1.2481 WP_000003851.1.24832 WP_000003851.1.24901 WP_000003851.1.24944 WP_000003851.1.24964 WP_000003851.1.25017 WP_000003851.1.25032 WP_000003851.1.25041 WP_000003851.1.25053 WP_000003851.1.25140 WP_000003851.1.25159 WP_000003851.1.25175 WP_000003851.1.25185 WP_000003851.1.25196 WP_000003851.1.25210 WP_000003851.1.25219 WP_000003851.1.25304 WP_000003851.1.25354 WP_000003851.1.25374 WP_000003851.1.25426 WP_000003851.1.25475 WP_000003851.1.25490 WP_000003851.1.25508 WP_000003851.1.25512 WP_000003851.1.25603 WP_000003851.1.25618 WP_000003851.1.2562 WP_000003851.1.25666 WP_000003851.1.25722 WP_000003851.1.25780 WP_000003851.1.25807 WP_000003851.1.25821 WP_000003851.1.25833 WP_000003851.1.25835 WP_000003851.1.25882 WP_000003851.1.25911 WP_000003851.1.25951 WP_000003851.1.25962 WP_000003851.1.25963 WP_000003851.1.26001 WP_000003851.1.26027 WP_000003851.1.26083 WP_000003851.1.26107 WP_000003851.1.2615 WP_000003851.1.26194 WP_000003851.1.26217 WP_000003851.1.26230 WP_000003851.1.26232 WP_000003851.1.26272 WP_000003851.1.26286 WP_000003851.1.26288 WP_000003851.1.26394 WP_000003851.1.26441 WP_000003851.1.26491 WP_000003851.1.2654 WP_000003851.1.26554 WP_000003851.1.26636 WP_000003851.1.26687 WP_000003851.1.26689 WP_000003851.1.2672 WP_000003851.1.2679 WP_000003851.1.26794 WP_000003851.1.26908 WP_000003851.1.2692 WP_000003851.1.26928 WP_000003851.1.26936 WP_000003851.1.270 WP_000003851.1.27008 WP_000003851.1.27027 WP_000003851.1.27070 WP_000003851.1.27077 WP_000003851.1.27086 WP_000003851.1.27087 WP_000003851.1.27111 WP_000003851.1.27115 WP_000003851.1.2713 WP_000003851.1.2717 WP_000003851.1.27228 WP_000003851.1.27272 WP_000003851.1.27282 WP_000003851.1.27285 WP_000003851.1.27309 WP_000003851.1.27314 WP_000003851.1.27329 WP_000003851.1.27361 WP_000003851.1.27383 WP_000003851.1.27547 WP_000003851.1.27565 WP_000003851.1.27595 WP_000003851.1.27598 WP_000003851.1.27632 WP_000003851.1.27638 WP_000003851.1.27658 WP_000003851.1.27706 WP_000003851.1.27775 WP_000003851.1.27785 WP_000003851.1.27815 WP_000003851.1.27833 WP_000003851.1.27883 WP_000003851.1.27900 WP_000003851.1.27928 WP_000003851.1.27945 WP_000003851.1.27995 WP_000003851.1.28004 WP_000003851.1.28037 WP_000003851.1.28056 WP_000003851.1.2809 WP_000003851.1.28155 WP_000003851.1.28198 WP_000003851.1.28200 WP_000003851.1.2822 WP_000003851.1.28229 WP_000003851.1.28232 WP_000003851.1.28233 WP_000003851.1.28303 WP_000003851.1.28384 WP_000003851.1.28386 WP_000003851.1.28395 WP_000003851.1.284 WP_000003851.1.2845 WP_000003851.1.28462 WP_000003851.1.28479 WP_000003851.1.2853 WP_000003851.1.28570 WP_000003851.1.28620 WP_000003851.1.28627 WP_000003851.1.28692 WP_000003851.1.2873 WP_000003851.1.28733 WP_000003851.1.28773 WP_000003851.1.28917 WP_000003851.1.28962 WP_000003851.1.29023 WP_000003851.1.29042 WP_000003851.1.2905 WP_000003851.1.2907 WP_000003851.1.29081 WP_000003851.1.29089 WP_000003851.1.29153 WP_000003851.1.29168 WP_000003851.1.29203 WP_000003851.1.29218 WP_000003851.1.29237 WP_000003851.1.2924 WP_000003851.1.29248 WP_000003851.1.29288 WP_000003851.1.2932 WP_000003851.1.29379 WP_000003851.1.29389 WP_000003851.1.29422 WP_000003851.1.29436 WP_000003851.1.29439 WP_000003851.1.2946 WP_000003851.1.29462 WP_000003851.1.29563 WP_000003851.1.29576 WP_000003851.1.29727 WP_000003851.1.29743 WP_000003851.1.29782 WP_000003851.1.29833 WP_000003851.1.29851 WP_000003851.1.29865 WP_000003851.1.29886 WP_000003851.1.29919 WP_000003851.1.2994 WP_000003851.1.29964 WP_000003851.1.29983 WP_000003851.1.30009 WP_000003851.1.30013 WP_000003851.1.3002 WP_000003851.1.30034 WP_000003851.1.30049 WP_000003851.1.3005 WP_000003851.1.30058 WP_000003851.1.30059 WP_000003851.1.30165 WP_000003851.1.30172 WP_000003851.1.30185 WP_000003851.1.30210 WP_000003851.1.30278 WP_000003851.1.30354 WP_000003851.1.30357 WP_000003851.1.30362 WP_000003851.1.3042 WP_000003851.1.30421 WP_000003851.1.30440 WP_000003851.1.30448 WP_000003851.1.30489 WP_000003851.1.30492 WP_000003851.1.30517 WP_000003851.1.30542 WP_000003851.1.30544 WP_000003851.1.30548 WP_000003851.1.30556 WP_000003851.1.30572 WP_000003851.1.30585 WP_000003851.1.30589 WP_000003851.1.30618 WP_000003851.1.30627 WP_000003851.1.30664 WP_000003851.1.30688 WP_000003851.1.30752 WP_000003851.1.30806 WP_000003851.1.30967 WP_000003851.1.30968 WP_000003851.1.31046 WP_000003851.1.31066 WP_000003851.1.31078 WP_000003851.1.31139 WP_000003851.1.31145 WP_000003851.1.31167 WP_000003851.1.31182 WP_000003851.1.31205 WP_000003851.1.3121 WP_000003851.1.31223 WP_000003851.1.31272 WP_000003851.1.31303 WP_000003851.1.3131 WP_000003851.1.31335 WP_000003851.1.31352 WP_000003851.1.31389 WP_000003851.1.31413 WP_000003851.1.31435 WP_000003851.1.31446 WP_000003851.1.31533 WP_000003851.1.31585 WP_000003851.1.3167 WP_000003851.1.31799 WP_000003851.1.31836 WP_000003851.1.31854 WP_000003851.1.31895 WP_000003851.1.31901 WP_000003851.1.31951 WP_000003851.1.32041 WP_000003851.1.32042 WP_000003851.1.3207 WP_000003851.1.32109 WP_000003851.1.32116 WP_000003851.1.32189 WP_000003851.1.32202 WP_000003851.1.32252 WP_000003851.1.32255 WP_000003851.1.32263 WP_000003851.1.32274 WP_000003851.1.32293 WP_000003851.1.32299 WP_000003851.1.32309 WP_000003851.1.32408 WP_000003851.1.32422 WP_000003851.1.32425 WP_000003851.1.32458 WP_000003851.1.32460 WP_000003851.1.32519 WP_000003851.1.32529 WP_000003851.1.32563 WP_000003851.1.32578 WP_000003851.1.32617 WP_000003851.1.32668 WP_000003851.1.3270 WP_000003851.1.32725 WP_000003851.1.32740 WP_000003851.1.32832 WP_000003851.1.32838 WP_000003851.1.32848 WP_000003851.1.32868 WP_000003851.1.32881 WP_000003851.1.32899 WP_000003851.1.3290 WP_000003851.1.32940 WP_000003851.1.32941 WP_000003851.1.3296 WP_000003851.1.32966 WP_000003851.1.32977 WP_000003851.1.32985 WP_000003851.1.33037 WP_000003851.1.3305 WP_000003851.1.33051 WP_000003851.1.33065 WP_000003851.1.33122 WP_000003851.1.3315 WP_000003851.1.33208 WP_000003851.1.33214 WP_000003851.1.33247 WP_000003851.1.33253 WP_000003851.1.33270 WP_000003851.1.33280 WP_000003851.1.33283 WP_000003851.1.33313 WP_000003851.1.33339 WP_000003851.1.33382 WP_000003851.1.33409 WP_000003851.1.33490 WP_000003851.1.335 WP_000003851.1.33501 WP_000003851.1.33529 WP_000003851.1.3356 WP_000003851.1.33586 WP_000003851.1.3364 WP_000003851.1.33689 WP_000003851.1.3370 WP_000003851.1.33730 WP_000003851.1.33741 WP_000003851.1.33840 WP_000003851.1.3392 WP_000003851.1.33926 WP_000003851.1.33957 WP_000003851.1.33969 WP_000003851.1.34 WP_000003851.1.34001 WP_000003851.1.34059 WP_000003851.1.34091 WP_000003851.1.34118 WP_000003851.1.34185 WP_000003851.1.34211 WP_000003851.1.34214 WP_000003851.1.34234 WP_000003851.1.34284 WP_000003851.1.34292 WP_000003851.1.34376 WP_000003851.1.3438 WP_000003851.1.34382 WP_000003851.1.34431 WP_000003851.1.34454 WP_000003851.1.34484 WP_000003851.1.34517 WP_000003851.1.34530 WP_000003851.1.34614 WP_000003851.1.34665 WP_000003851.1.34694 WP_000003851.1.34711 WP_000003851.1.34751 WP_000003851.1.3476 WP_000003851.1.34808 WP_000003851.1.34820 WP_000003851.1.34824 WP_000003851.1.34834 WP_000003851.1.34932 WP_000003851.1.34962 WP_000003851.1.35001 WP_000003851.1.35040 WP_000003851.1.35074 WP_000003851.1.35175 WP_000003851.1.35240 WP_000003851.1.35274 WP_000003851.1.35298 WP_000003851.1.35321 WP_000003851.1.35532 WP_000003851.1.35560 WP_000003851.1.35563 WP_000003851.1.3557 WP_000003851.1.35570 WP_000003851.1.35594 WP_000003851.1.35624 WP_000003851.1.35628 WP_000003851.1.3570 WP_000003851.1.35712 WP_000003851.1.35713 WP_000003851.1.35736 WP_000003851.1.35791 WP_000003851.1.35795 WP_000003851.1.35870 WP_000003851.1.35887 WP_000003851.1.35916 WP_000003851.1.35936 WP_000003851.1.35938 WP_000003851.1.35961 WP_000003851.1.35966 WP_000003851.1.36000 WP_000003851.1.36034 WP_000003851.1.36036 WP_000003851.1.36037 WP_000003851.1.36063 WP_000003851.1.36069 WP_000003851.1.36291 WP_000003851.1.36298 WP_000003851.1.36308 WP_000003851.1.36323 WP_000003851.1.36343 WP_000003851.1.36409 WP_000003851.1.36445 WP_000003851.1.36460 WP_000003851.1.3649 WP_000003851.1.36495 WP_000003851.1.36526 WP_000003851.1.36567 WP_000003851.1.36579 WP_000003851.1.36584 WP_000003851.1.36617 WP_000003851.1.36618 WP_000003851.1.36643 WP_000003851.1.36663 WP_000003851.1.36685 WP_000003851.1.36701 WP_000003851.1.36721 WP_000003851.1.36725 WP_000003851.1.36751 WP_000003851.1.36764 WP_000003851.1.36779 WP_000003851.1.36798 WP_000003851.1.36802 WP_000003851.1.36821 WP_000003851.1.36853 WP_000003851.1.36889 WP_000003851.1.36899 WP_000003851.1.36950 WP_000003851.1.37014 WP_000003851.1.37029 WP_000003851.1.37114 WP_000003851.1.37133 WP_000003851.1.37176 WP_000003851.1.37191 WP_000003851.1.37199 WP_000003851.1.37200 WP_000003851.1.37258 WP_000003851.1.37297 WP_000003851.1.37303 WP_000003851.1.37405 WP_000003851.1.3748 WP_000003851.1.37513 WP_000003851.1.37584 WP_000003851.1.37590 WP_000003851.1.37593 WP_000003851.1.37600 WP_000003851.1.37613 WP_000003851.1.37659 WP_000003851.1.37662 WP_000003851.1.37675 WP_000003851.1.37691 WP_000003851.1.3771 WP_000003851.1.37761 WP_000003851.1.37775 WP_000003851.1.37777 WP_000003851.1.3778 WP_000003851.1.378 WP_000003851.1.37864 WP_000003851.1.379 WP_000003851.1.3790 WP_000003851.1.37911 WP_000003851.1.37941 WP_000003851.1.37985 WP_000003851.1.38037 WP_000003851.1.38047 WP_000003851.1.38061 WP_000003851.1.38064 WP_000003851.1.38108 WP_000003851.1.3816 WP_000003851.1.38207 WP_000003851.1.38261 WP_000003851.1.38266 WP_000003851.1.38310 WP_000003851.1.3834 WP_000003851.1.38344 WP_000003851.1.38351 WP_000003851.1.3838 WP_000003851.1.38381 WP_000003851.1.38440 WP_000003851.1.38486 WP_000003851.1.38515 WP_000003851.1.38595 WP_000003851.1.3860 WP_000003851.1.38642 WP_000003851.1.38734 WP_000003851.1.38877 WP_000003851.1.38983 WP_000003851.1.38996 WP_000003851.1.39048 WP_000003851.1.39055 WP_000003851.1.39056 WP_000003851.1.39065 WP_000003851.1.39105 WP_000003851.1.3914 WP_000003851.1.39147 WP_000003851.1.39161 WP_000003851.1.39210 WP_000003851.1.39235 WP_000003851.1.3931 WP_000003851.1.39312 WP_000003851.1.39395 WP_000003851.1.39435 WP_000003851.1.39502 WP_000003851.1.39530 WP_000003851.1.39553 WP_000003851.1.39619 WP_000003851.1.39620 WP_000003851.1.39624 WP_000003851.1.39659 WP_000003851.1.39667 WP_000003851.1.39775 WP_000003851.1.39879 WP_000003851.1.39890 WP_000003851.1.39941 WP_000003851.1.39945 WP_000003851.1.39947 WP_000003851.1.40081 WP_000003851.1.40095 WP_000003851.1.40097 WP_000003851.1.401 WP_000003851.1.40160 WP_000003851.1.40167 WP_000003851.1.40279 WP_000003851.1.40307 WP_000003851.1.40361 WP_000003851.1.4042 WP_000003851.1.40467 WP_000003851.1.40493 WP_000003851.1.40496 WP_000003851.1.40517 WP_000003851.1.40533 WP_000003851.1.40577 WP_000003851.1.40622 WP_000003851.1.40695 WP_000003851.1.40745 WP_000003851.1.40750 WP_000003851.1.40763 WP_000003851.1.40849 WP_000003851.1.40854 WP_000003851.1.4089 WP_000003851.1.40924 WP_000003851.1.40930 WP_000003851.1.40932 WP_000003851.1.40946 WP_000003851.1.40973 WP_000003851.1.41004 WP_000003851.1.4106 WP_000003851.1.41070 WP_000003851.1.41074 WP_000003851.1.41075 WP_000003851.1.41097 WP_000003851.1.41116 WP_000003851.1.41128 WP_000003851.1.41132 WP_000003851.1.41176 WP_000003851.1.41192 WP_000003851.1.41251 WP_000003851.1.41258 WP_000003851.1.41277 WP_000003851.1.41305 WP_000003851.1.41321 WP_000003851.1.41333 WP_000003851.1.41335 WP_000003851.1.4136 WP_000003851.1.41415 WP_000003851.1.41427 WP_000003851.1.41459 WP_000003851.1.41498 WP_000003851.1.41519 WP_000003851.1.41524 WP_000003851.1.41528 WP_000003851.1.41610 WP_000003851.1.41631 WP_000003851.1.41658 WP_000003851.1.41659 WP_000003851.1.41688 WP_000003851.1.41690 WP_000003851.1.41716 WP_000003851.1.41746 WP_000003851.1.41799 WP_000003851.1.41824 WP_000003851.1.41825 WP_000003851.1.41836 WP_000003851.1.41894 WP_000003851.1.41911 WP_000003851.1.41919 WP_000003851.1.41929 WP_000003851.1.4194 WP_000003851.1.41949 WP_000003851.1.41978 WP_000003851.1.42069 WP_000003851.1.42081 WP_000003851.1.42090 WP_000003851.1.42111 WP_000003851.1.42136 WP_000003851.1.42187 WP_000003851.1.422 WP_000003851.1.42200 WP_000003851.1.42219 WP_000003851.1.42257 WP_000003851.1.42261 WP_000003851.1.42263 WP_000003851.1.42322 WP_000003851.1.42349 WP_000003851.1.42364 WP_000003851.1.42371 WP_000003851.1.42379 WP_000003851.1.42391 WP_000003851.1.42392 WP_000003851.1.42399 WP_000003851.1.42539 WP_000003851.1.42603 WP_000003851.1.42650 WP_000003851.1.42666 WP_000003851.1.4267 WP_000003851.1.42675 WP_000003851.1.42683 WP_000003851.1.42701 WP_000003851.1.42734 WP_000003851.1.42805 WP_000003851.1.42815 WP_000003851.1.42859 WP_000003851.1.42892 WP_000003851.1.42932 WP_000003851.1.4298 WP_000003851.1.43008 WP_000003851.1.43016 WP_000003851.1.43019 WP_000003851.1.43065 WP_000003851.1.43068 WP_000003851.1.43069 WP_000003851.1.43086 WP_000003851.1.43128 WP_000003851.1.43141 WP_000003851.1.43157 WP_000003851.1.43161 WP_000003851.1.43190 WP_000003851.1.43198 WP_000003851.1.43201 WP_000003851.1.4326 WP_000003851.1.43290 WP_000003851.1.43292 WP_000003851.1.43307 WP_000003851.1.4344 WP_000003851.1.43513 WP_000003851.1.43633 WP_000003851.1.43637 WP_000003851.1.43651 WP_000003851.1.43711 WP_000003851.1.43722 WP_000003851.1.43785 WP_000003851.1.43801 WP_000003851.1.43812 WP_000003851.1.43878 WP_000003851.1.43888 WP_000003851.1.43919 WP_000003851.1.43974 WP_000003851.1.44010 WP_000003851.1.44049 WP_000003851.1.44101 WP_000003851.1.44160 WP_000003851.1.44180 WP_000003851.1.44196 WP_000003851.1.44248 WP_000003851.1.44262 WP_000003851.1.44268 WP_000003851.1.4427 WP_000003851.1.44296 WP_000003851.1.44337 WP_000003851.1.44343 WP_000003851.1.44351 WP_000003851.1.44360 WP_000003851.1.44416 WP_000003851.1.44431 WP_000003851.1.44437 WP_000003851.1.44474 WP_000003851.1.44546 WP_000003851.1.4468 WP_000003851.1.44705 WP_000003851.1.44762 WP_000003851.1.44815 WP_000003851.1.44828 WP_000003851.1.44831 WP_000003851.1.44879 WP_000003851.1.44917 WP_000003851.1.44966 WP_000003851.1.44978 WP_000003851.1.44997 WP_000003851.1.4500 WP_000003851.1.4501 WP_000003851.1.45072 WP_000003851.1.45093 WP_000003851.1.45136 WP_000003851.1.45173 WP_000003851.1.45241 WP_000003851.1.45302 WP_000003851.1.4531 WP_000003851.1.45432 WP_000003851.1.45435 WP_000003851.1.45523 WP_000003851.1.45549 WP_000003851.1.45569 WP_000003851.1.45571 WP_000003851.1.45583 WP_000003851.1.45596 WP_000003851.1.45648 WP_000003851.1.45706 WP_000003851.1.45829 WP_000003851.1.45844 WP_000003851.1.45871 WP_000003851.1.45906 WP_000003851.1.45918 WP_000003851.1.46030 WP_000003851.1.46077 WP_000003851.1.46169 WP_000003851.1.46225 WP_000003851.1.46241 WP_000003851.1.46307 WP_000003851.1.46355 WP_000003851.1.464 WP_000003851.1.46454 WP_000003851.1.46461 WP_000003851.1.46504 WP_000003851.1.46505 WP_000003851.1.46551 WP_000003851.1.46559 WP_000003851.1.46578 WP_000003851.1.46701 WP_000003851.1.46726 WP_000003851.1.4674 WP_000003851.1.46781 WP_000003851.1.46816 WP_000003851.1.46842 WP_000003851.1.4686 WP_000003851.1.4690 WP_000003851.1.46920 WP_000003851.1.46945 WP_000003851.1.46967 WP_000003851.1.46976 WP_000003851.1.47036 WP_000003851.1.47037 WP_000003851.1.47042 WP_000003851.1.47059 WP_000003851.1.47085 WP_000003851.1.47123 WP_000003851.1.47215 WP_000003851.1.47245 WP_000003851.1.47507 WP_000003851.1.47523 WP_000003851.1.47531 WP_000003851.1.47532 WP_000003851.1.47567 WP_000003851.1.47576 WP_000003851.1.4758 WP_000003851.1.47605 WP_000003851.1.47630 WP_000003851.1.4774 WP_000003851.1.47756 WP_000003851.1.4781 WP_000003851.1.47829 WP_000003851.1.47850 WP_000003851.1.47875 WP_000003851.1.47886 WP_000003851.1.47898 WP_000003851.1.47911 WP_000003851.1.4795 WP_000003851.1.47988 WP_000003851.1.48019 WP_000003851.1.48100 WP_000003851.1.48114 WP_000003851.1.48139 WP_000003851.1.48190 WP_000003851.1.48292 WP_000003851.1.48324 WP_000003851.1.4839 WP_000003851.1.48426 WP_000003851.1.48430 WP_000003851.1.48436 WP_000003851.1.48586 WP_000003851.1.4859 WP_000003851.1.48591 WP_000003851.1.48610 WP_000003851.1.48631 WP_000003851.1.48663 WP_000003851.1.48690 WP_000003851.1.48734 WP_000003851.1.48756 WP_000003851.1.48778 WP_000003851.1.48797 WP_000003851.1.48849 WP_000003851.1.48955 WP_000003851.1.48963 WP_000003851.1.48973 WP_000003851.1.49004 WP_000003851.1.49106 WP_000003851.1.49117 WP_000003851.1.49121 WP_000003851.1.4914 WP_000003851.1.49140 WP_000003851.1.49153 WP_000003851.1.49166 WP_000003851.1.49233 WP_000003851.1.49311 WP_000003851.1.49334 WP_000003851.1.49355 WP_000003851.1.49429 WP_000003851.1.49434 WP_000003851.1.49450 WP_000003851.1.495 WP_000003851.1.49545 WP_000003851.1.49703 WP_000003851.1.49769 WP_000003851.1.49770 WP_000003851.1.49846 WP_000003851.1.4991 WP_000003851.1.49947 WP_000003851.1.49959 WP_000003851.1.49997 WP_000003851.1.50014 WP_000003851.1.50030 WP_000003851.1.50043 WP_000003851.1.50103 WP_000003851.1.50128 WP_000003851.1.50158 WP_000003851.1.50247 WP_000003851.1.50308 WP_000003851.1.50309 WP_000003851.1.50332 WP_000003851.1.50387 WP_000003851.1.50406 WP_000003851.1.50449 WP_000003851.1.50468 WP_000003851.1.5051 WP_000003851.1.50566 WP_000003851.1.50570 WP_000003851.1.50576 WP_000003851.1.50626 WP_000003851.1.50652 WP_000003851.1.50684 WP_000003851.1.50726 WP_000003851.1.50771 WP_000003851.1.50875 WP_000003851.1.50882 WP_000003851.1.50885 WP_000003851.1.509 WP_000003851.1.50929 WP_000003851.1.50960 WP_000003851.1.50970 WP_000003851.1.51040 WP_000003851.1.51048 WP_000003851.1.51100 WP_000003851.1.51134 WP_000003851.1.51227 WP_000003851.1.5127 WP_000003851.1.51305 WP_000003851.1.51315 WP_000003851.1.51356 WP_000003851.1.5136 WP_000003851.1.51412 WP_000003851.1.51451 WP_000003851.1.51474 WP_000003851.1.51502 WP_000003851.1.51519 WP_000003851.1.51598 WP_000003851.1.51642 WP_000003851.1.51644 WP_000003851.1.51724 WP_000003851.1.51734 WP_000003851.1.51764 WP_000003851.1.51810 WP_000003851.1.51838 WP_000003851.1.51863 WP_000003851.1.51868 WP_000003851.1.51930 WP_000003851.1.51935 WP_000003851.1.51994 WP_000003851.1.520 WP_000003851.1.52057 WP_000003851.1.5211 WP_000003851.1.52114 WP_000003851.1.52129 WP_000003851.1.52191 WP_000003851.1.52202 WP_000003851.1.52209 WP_000003851.1.52301 WP_000003851.1.52321 WP_000003851.1.52339 WP_000003851.1.52469 WP_000003851.1.52571 WP_000003851.1.52582 WP_000003851.1.52586 WP_000003851.1.526 WP_000003851.1.52647 WP_000003851.1.52742 WP_000003851.1.52773 WP_000003851.1.52795 WP_000003851.1.52807 WP_000003851.1.52833 WP_000003851.1.52887 WP_000003851.1.53092 WP_000003851.1.53107 WP_000003851.1.53119 WP_000003851.1.5313 WP_000003851.1.53141 WP_000003851.1.53151 WP_000003851.1.53154 WP_000003851.1.53159 WP_000003851.1.53198 WP_000003851.1.53206 WP_000003851.1.53210 WP_000003851.1.53233 WP_000003851.1.53234 WP_000003851.1.53307 WP_000003851.1.53321 WP_000003851.1.53362 WP_000003851.1.53368 WP_000003851.1.53375 WP_000003851.1.53385 WP_000003851.1.53450 WP_000003851.1.5349 WP_000003851.1.53540 WP_000003851.1.53555 WP_000003851.1.53559 WP_000003851.1.5356 WP_000003851.1.53567 WP_000003851.1.53571 WP_000003851.1.5358 WP_000003851.1.53664 WP_000003851.1.53692 WP_000003851.1.53723 WP_000003851.1.5374 WP_000003851.1.53750 WP_000003851.1.53778 WP_000003851.1.53781 WP_000003851.1.53800 WP_000003851.1.53815 WP_000003851.1.53839 WP_000003851.1.53892 WP_000003851.1.53896 WP_000003851.1.53898 WP_000003851.1.53902 WP_000003851.1.53958 WP_000003851.1.53961 WP_000003851.1.53981 WP_000003851.1.53984 WP_000003851.1.54132 WP_000003851.1.54170 WP_000003851.1.54175 WP_000003851.1.54203 WP_000003851.1.54259 WP_000003851.1.54283 WP_000003851.1.5430 WP_000003851.1.54333 WP_000003851.1.54366 WP_000003851.1.54371 WP_000003851.1.54431 WP_000003851.1.54442 WP_000003851.1.54482 WP_000003851.1.54589 WP_000003851.1.54615 WP_000003851.1.54667 WP_000003851.1.54678 WP_000003851.1.54681 WP_000003851.1.54748 WP_000003851.1.5481 WP_000003851.1.54833 WP_000003851.1.54865 WP_000003851.1.54877 WP_000003851.1.5493 WP_000003851.1.54935 WP_000003851.1.54936 WP_000003851.1.54979 WP_000003851.1.55010 WP_000003851.1.55034 WP_000003851.1.55163 WP_000003851.1.55165 WP_000003851.1.55215 WP_000003851.1.55290 WP_000003851.1.55310 WP_000003851.1.55317 WP_000003851.1.55379 WP_000003851.1.5539 WP_000003851.1.55468 WP_000003851.1.55506 WP_000003851.1.55559 WP_000003851.1.55604 WP_000003851.1.55639 WP_000003851.1.55640 WP_000003851.1.55699 WP_000003851.1.5572 WP_000003851.1.55725 WP_000003851.1.5577 WP_000003851.1.55780 WP_000003851.1.55923 WP_000003851.1.55948 WP_000003851.1.55967 WP_000003851.1.56100 WP_000003851.1.56144 WP_000003851.1.56172 WP_000003851.1.5621 WP_000003851.1.56226 WP_000003851.1.56235 WP_000003851.1.56263 WP_000003851.1.56311 WP_000003851.1.56419 WP_000003851.1.56423 WP_000003851.1.56514 WP_000003851.1.56535 WP_000003851.1.56585 WP_000003851.1.56640 WP_000003851.1.5668 WP_000003851.1.56724 WP_000003851.1.56825 WP_000003851.1.56851 WP_000003851.1.56861 WP_000003851.1.56887 WP_000003851.1.56889 WP_000003851.1.56898 WP_000003851.1.56981 WP_000003851.1.57026 WP_000003851.1.57039 WP_000003851.1.57056 WP_000003851.1.57101 WP_000003851.1.5711 WP_000003851.1.57137 WP_000003851.1.57143 WP_000003851.1.57147 WP_000003851.1.57179 WP_000003851.1.57186 WP_000003851.1.57246 WP_000003851.1.57296 WP_000003851.1.57342 WP_000003851.1.57362 WP_000003851.1.57559 WP_000003851.1.57631 WP_000003851.1.57641 WP_000003851.1.57684 WP_000003851.1.57699 WP_000003851.1.57785 WP_000003851.1.57800 WP_000003851.1.57835 WP_000003851.1.57873 WP_000003851.1.57893 WP_000003851.1.57965 WP_000003851.1.57972 WP_000003851.1.58008 WP_000003851.1.58044 WP_000003851.1.58081 WP_000003851.1.5809 WP_000003851.1.58090 WP_000003851.1.58132 WP_000003851.1.58173 WP_000003851.1.58191 WP_000003851.1.58194 WP_000003851.1.58252 WP_000003851.1.58261 WP_000003851.1.58274 WP_000003851.1.5828 WP_000003851.1.58282 WP_000003851.1.58290 WP_000003851.1.58324 WP_000003851.1.58326 WP_000003851.1.5836 WP_000003851.1.58443 WP_000003851.1.58485 WP_000003851.1.58486 WP_000003851.1.58489 WP_000003851.1.58537 WP_000003851.1.58568 WP_000003851.1.58583 WP_000003851.1.58652 WP_000003851.1.58663 WP_000003851.1.58675 WP_000003851.1.587 WP_000003851.1.58724 WP_000003851.1.5875 WP_000003851.1.58796 WP_000003851.1.58807 WP_000003851.1.58847 WP_000003851.1.58883 WP_000003851.1.58884 WP_000003851.1.58898 WP_000003851.1.58926 WP_000003851.1.58932 WP_000003851.1.58949 WP_000003851.1.58963 WP_000003851.1.58970 WP_000003851.1.58974 WP_000003851.1.59020 WP_000003851.1.59043 WP_000003851.1.59056 WP_000003851.1.59061 WP_000003851.1.59064 WP_000003851.1.59142 WP_000003851.1.59163 WP_000003851.1.59282 WP_000003851.1.59299 WP_000003851.1.59313 WP_000003851.1.59427 WP_000003851.1.5949 WP_000003851.1.59501 WP_000003851.1.59510 WP_000003851.1.59548 WP_000003851.1.59646 WP_000003851.1.5969 WP_000003851.1.59751 WP_000003851.1.59827 WP_000003851.1.59829 WP_000003851.1.59847 WP_000003851.1.59848 WP_000003851.1.59863 WP_000003851.1.59969 WP_000003851.1.59994 WP_000003851.1.60004 WP_000003851.1.60045 WP_000003851.1.60076 WP_000003851.1.60106 WP_000003851.1.60114 WP_000003851.1.60126 WP_000003851.1.60137 WP_000003851.1.60154 WP_000003851.1.60168 WP_000003851.1.60192 WP_000003851.1.60199 WP_000003851.1.60212 WP_000003851.1.60253 WP_000003851.1.60320 WP_000003851.1.60322 WP_000003851.1.60324 WP_000003851.1.6033 WP_000003851.1.60356 WP_000003851.1.6038 WP_000003851.1.60380 WP_000003851.1.6041 WP_000003851.1.60424 WP_000003851.1.60425 WP_000003851.1.60481 WP_000003851.1.605 WP_000003851.1.60560 WP_000003851.1.6058 WP_000003851.1.60584 WP_000003851.1.6060 WP_000003851.1.60676 WP_000003851.1.60708 WP_000003851.1.60713 WP_000003851.1.60725 WP_000003851.1.60783 WP_000003851.1.60792 WP_000003851.1.608 WP_000003851.1.60807 WP_000003851.1.60866 WP_000003851.1.60882 WP_000003851.1.60889 WP_000003851.1.60897 WP_000003851.1.60950 WP_000003851.1.6104 WP_000003851.1.61044 WP_000003851.1.61076 WP_000003851.1.61123 WP_000003851.1.61147 WP_000003851.1.61168 WP_000003851.1.61201 WP_000003851.1.61210 WP_000003851.1.61356 WP_000003851.1.61357 WP_000003851.1.61381 WP_000003851.1.61501 WP_000003851.1.61511 WP_000003851.1.61539 WP_000003851.1.61542 WP_000003851.1.61594 WP_000003851.1.61595 WP_000003851.1.61649 WP_000003851.1.61652 WP_000003851.1.61671 WP_000003851.1.61697 WP_000003851.1.61809 WP_000003851.1.61877 WP_000003851.1.61908 WP_000003851.1.61920 WP_000003851.1.62124 WP_000003851.1.62158 WP_000003851.1.62199 WP_000003851.1.62201 WP_000003851.1.62210 WP_000003851.1.62302 WP_000003851.1.62314 WP_000003851.1.62323 WP_000003851.1.62333 WP_000003851.1.62338 WP_000003851.1.62380 WP_000003851.1.62411 WP_000003851.1.62412 WP_000003851.1.62436 WP_000003851.1.62475 WP_000003851.1.62536 WP_000003851.1.62640 WP_000003851.1.627 WP_000003851.1.62745 WP_000003851.1.62751 WP_000003851.1.62757 WP_000003851.1.62825 WP_000003851.1.62913 WP_000003851.1.6292 WP_000003851.1.62932 WP_000003851.1.62960 WP_000003851.1.62983 WP_000003851.1.62988 WP_000003851.1.63016 WP_000003851.1.63025 WP_000003851.1.63045 WP_000003851.1.63069 WP_000003851.1.63087 WP_000003851.1.63102 WP_000003851.1.63169 WP_000003851.1.63229 WP_000003851.1.63297 WP_000003851.1.63358 WP_000003851.1.63422 WP_000003851.1.63448 WP_000003851.1.63497 WP_000003851.1.63509 WP_000003851.1.63514 WP_000003851.1.63529 WP_000003851.1.63583 WP_000003851.1.63585 WP_000003851.1.63592 WP_000003851.1.63603 WP_000003851.1.63663 WP_000003851.1.6370 WP_000003851.1.63736 WP_000003851.1.63748 WP_000003851.1.63766 WP_000003851.1.63816 WP_000003851.1.63851 WP_000003851.1.63876 WP_000003851.1.6389 WP_000003851.1.63901 WP_000003851.1.63955 WP_000003851.1.63963 WP_000003851.1.64010 WP_000003851.1.64032 WP_000003851.1.64085 WP_000003851.1.64087 WP_000003851.1.64109 WP_000003851.1.6415 WP_000003851.1.64157 WP_000003851.1.64229 WP_000003851.1.64293 WP_000003851.1.64332 WP_000003851.1.64376 WP_000003851.1.64385 WP_000003851.1.644 WP_000003851.1.64412 WP_000003851.1.64462 WP_000003851.1.64471 WP_000003851.1.64500 WP_000003851.1.64501 WP_000003851.1.64538 WP_000003851.1.64597 WP_000003851.1.64632 WP_000003851.1.64648 WP_000003851.1.64654 WP_000003851.1.64662 WP_000003851.1.64663 WP_000003851.1.64709 WP_000003851.1.64710 WP_000003851.1.64711 WP_000003851.1.64744 WP_000003851.1.64763 WP_000003851.1.64817 WP_000003851.1.64847 WP_000003851.1.6487 WP_000003851.1.64891 WP_000003851.1.64920 WP_000003851.1.64974 WP_000003851.1.65011 WP_000003851.1.65054 WP_000003851.1.65075 WP_000003851.1.6514 WP_000003851.1.65172 WP_000003851.1.65191 WP_000003851.1.65200 WP_000003851.1.65211 WP_000003851.1.65218 WP_000003851.1.65226 WP_000003851.1.65249 WP_000003851.1.65266 WP_000003851.1.65357 WP_000003851.1.65395 WP_000003851.1.65459 WP_000003851.1.65463 WP_000003851.1.65487 WP_000003851.1.6549 WP_000003851.1.65499 WP_000003851.1.6554 WP_000003851.1.65601 WP_000003851.1.65650 WP_000003851.1.65697 WP_000003851.1.65698 WP_000003851.1.65699 WP_000003851.1.65737 WP_000003851.1.65755 WP_000003851.1.65771 WP_000003851.1.65812 WP_000003851.1.65846 WP_000003851.1.65863 WP_000003851.1.65881 WP_000003851.1.65883 WP_000003851.1.65901 WP_000003851.1.6595 WP_000003851.1.65985 WP_000003851.1.66021 WP_000003851.1.66031 WP_000003851.1.66052 WP_000003851.1.66064 WP_000003851.1.66109 WP_000003851.1.66145 WP_000003851.1.66171 WP_000003851.1.66183 WP_000003851.1.6620 WP_000003851.1.66216 WP_000003851.1.66234 WP_000003851.1.66273 WP_000003851.1.66315 WP_000003851.1.66324 WP_000003851.1.6634 WP_000003851.1.66361 WP_000003851.1.66385 WP_000003851.1.66400 WP_000003851.1.66428 WP_000003851.1.66446 WP_000003851.1.66480 WP_000003851.1.66506 WP_000003851.1.66539 WP_000003851.1.66665 WP_000003851.1.66681 WP_000003851.1.66684 WP_000003851.1.66733 WP_000003851.1.66755 WP_000003851.1.66759 WP_000003851.1.66801 WP_000003851.1.66860 WP_000003851.1.6692 WP_000003851.1.66953 WP_000003851.1.66955 WP_000003851.1.66959 WP_000003851.1.66981 WP_000003851.1.67024 WP_000003851.1.67042 WP_000003851.1.67075 WP_000003851.1.6710 WP_000003851.1.67101 WP_000003851.1.67143 WP_000003851.1.67173 WP_000003851.1.67201 WP_000003851.1.67211 WP_000003851.1.67237 WP_000003851.1.67279 WP_000003851.1.67336 WP_000003851.1.67339 WP_000003851.1.67387 WP_000003851.1.67394 WP_000003851.1.67397 WP_000003851.1.67403 WP_000003851.1.67430 WP_000003851.1.67442 WP_000003851.1.67539 WP_000003851.1.67556 WP_000003851.1.67576 WP_000003851.1.6760 WP_000003851.1.67604 WP_000003851.1.67619 WP_000003851.1.67625 WP_000003851.1.67627 WP_000003851.1.67641 WP_000003851.1.67657 WP_000003851.1.67673 WP_000003851.1.67700 WP_000003851.1.67718 WP_000003851.1.67729 WP_000003851.1.67774 WP_000003851.1.6782 WP_000003851.1.67820 WP_000003851.1.67910 WP_000003851.1.67932 WP_000003851.1.67954 WP_000003851.1.68 WP_000003851.1.68043 WP_000003851.1.68105 WP_000003851.1.68113 WP_000003851.1.68131 WP_000003851.1.68140 WP_000003851.1.68159 WP_000003851.1.68182 WP_000003851.1.6819 WP_000003851.1.68285 WP_000003851.1.68359 WP_000003851.1.68420 WP_000003851.1.68514 WP_000003851.1.68564 WP_000003851.1.68652 WP_000003851.1.68677 WP_000003851.1.68688 WP_000003851.1.68742 WP_000003851.1.68770 WP_000003851.1.68809 WP_000003851.1.68893 WP_000003851.1.68895 WP_000003851.1.68914 WP_000003851.1.69053 WP_000003851.1.69080 WP_000003851.1.69086 WP_000003851.1.69131 WP_000003851.1.69170 WP_000003851.1.69210 WP_000003851.1.69236 WP_000003851.1.69270 WP_000003851.1.69273 WP_000003851.1.69282 WP_000003851.1.69357 WP_000003851.1.69376 WP_000003851.1.69396 WP_000003851.1.69466 WP_000003851.1.69575 WP_000003851.1.69611 WP_000003851.1.69616 WP_000003851.1.69642 WP_000003851.1.69656 WP_000003851.1.69657 WP_000003851.1.69690 WP_000003851.1.69767 WP_000003851.1.69890 WP_000003851.1.69923 WP_000003851.1.69948 WP_000003851.1.69953 WP_000003851.1.69965 WP_000003851.1.70049 WP_000003851.1.70058 WP_000003851.1.70061 WP_000003851.1.70088 WP_000003851.1.70205 WP_000003851.1.70240 WP_000003851.1.70249 WP_000003851.1.70261 WP_000003851.1.70272 WP_000003851.1.70314 WP_000003851.1.7033 WP_000003851.1.70427 WP_000003851.1.70433 WP_000003851.1.70440 WP_000003851.1.70488 WP_000003851.1.70531 WP_000003851.1.70545 WP_000003851.1.70580 WP_000003851.1.70596 WP_000003851.1.70623 WP_000003851.1.70671 WP_000003851.1.70678 WP_000003851.1.70679 WP_000003851.1.70708 WP_000003851.1.70717 WP_000003851.1.70731 WP_000003851.1.70772 WP_000003851.1.70785 WP_000003851.1.70837 WP_000003851.1.70845 WP_000003851.1.70846 WP_000003851.1.70981 WP_000003851.1.70985 WP_000003851.1.70995 WP_000003851.1.71010 WP_000003851.1.71039 WP_000003851.1.71057 WP_000003851.1.71081 WP_000003851.1.71117 WP_000003851.1.71172 WP_000003851.1.71184 WP_000003851.1.71186 WP_000003851.1.71201 WP_000003851.1.71305 WP_000003851.1.71455 WP_000003851.1.71456 WP_000003851.1.71487 WP_000003851.1.71523 WP_000003851.1.71542 WP_000003851.1.71566 WP_000003851.1.71626 WP_000003851.1.71640 WP_000003851.1.71649 WP_000003851.1.71651 WP_000003851.1.71653 WP_000003851.1.71716 WP_000003851.1.71872 WP_000003851.1.71950 WP_000003851.1.71954 WP_000003851.1.71979 WP_000003851.1.71984 WP_000003851.1.71985 WP_000003851.1.720 WP_000003851.1.72003 WP_000003851.1.72073 WP_000003851.1.72100 WP_000003851.1.72190 WP_000003851.1.72221 WP_000003851.1.72269 WP_000003851.1.72300 WP_000003851.1.72325 WP_000003851.1.72339 WP_000003851.1.72350 WP_000003851.1.72383 WP_000003851.1.72461 WP_000003851.1.72527 WP_000003851.1.72532 WP_000003851.1.7255 WP_000003851.1.72602 WP_000003851.1.72638 WP_000003851.1.72667 WP_000003851.1.72674 WP_000003851.1.72716 WP_000003851.1.72718 WP_000003851.1.72724 WP_000003851.1.72789 WP_000003851.1.72828 WP_000003851.1.72865 WP_000003851.1.72896 WP_000003851.1.7295 WP_000003851.1.72969 WP_000003851.1.72987 WP_000003851.1.73052 WP_000003851.1.73068 WP_000003851.1.7311 WP_000003851.1.73114 WP_000003851.1.73177 WP_000003851.1.73180 WP_000003851.1.73258 WP_000003851.1.73285 WP_000003851.1.7332 WP_000003851.1.7333 WP_000003851.1.73352 WP_000003851.1.73389 WP_000003851.1.73488 WP_000003851.1.73504 WP_000003851.1.7353 WP_000003851.1.73544 WP_000003851.1.73598 WP_000003851.1.7361 WP_000003851.1.73648 WP_000003851.1.73708 WP_000003851.1.73768 WP_000003851.1.73849 WP_000003851.1.73948 WP_000003851.1.73999 WP_000003851.1.74024 WP_000003851.1.74030 WP_000003851.1.74038 WP_000003851.1.74043 WP_000003851.1.74049 WP_000003851.1.74058 WP_000003851.1.74070 WP_000003851.1.74077 WP_000003851.1.74135 WP_000003851.1.74174 WP_000003851.1.74207 WP_000003851.1.74214 WP_000003851.1.74241 WP_000003851.1.74248 WP_000003851.1.74285 WP_000003851.1.743 WP_000003851.1.7430 WP_000003851.1.74300 WP_000003851.1.74317 WP_000003851.1.74402 WP_000003851.1.74415 WP_000003851.1.74578 WP_000003851.1.74616 WP_000003851.1.74621 WP_000003851.1.74647 WP_000003851.1.74677 WP_000003851.1.74699 WP_000003851.1.74826 WP_000003851.1.74831 WP_000003851.1.74894 WP_000003851.1.74929 WP_000003851.1.74939 WP_000003851.1.74972 WP_000003851.1.74973 WP_000003851.1.75051 WP_000003851.1.75056 WP_000003851.1.7507 WP_000003851.1.75089 WP_000003851.1.75116 WP_000003851.1.75148 WP_000003851.1.75159 WP_000003851.1.75237 WP_000003851.1.75273 WP_000003851.1.75296 WP_000003851.1.75400 WP_000003851.1.75413 WP_000003851.1.75433 WP_000003851.1.75450 WP_000003851.1.75532 WP_000003851.1.75565 WP_000003851.1.7558 WP_000003851.1.75593 WP_000003851.1.75607 WP_000003851.1.75610 WP_000003851.1.75633 WP_000003851.1.75716 WP_000003851.1.75718 WP_000003851.1.75745 WP_000003851.1.75751 WP_000003851.1.75794 WP_000003851.1.75810 WP_000003851.1.75844 WP_000003851.1.75863 WP_000003851.1.75886 WP_000003851.1.75898 WP_000003851.1.76081 WP_000003851.1.76108 WP_000003851.1.76116 WP_000003851.1.76122 WP_000003851.1.76137 WP_000003851.1.76256 WP_000003851.1.76339 WP_000003851.1.76345 WP_000003851.1.76366 WP_000003851.1.76417 WP_000003851.1.76451 WP_000003851.1.7646 WP_000003851.1.76495 WP_000003851.1.76510 WP_000003851.1.76558 WP_000003851.1.76572 WP_000003851.1.76641 WP_000003851.1.76651 WP_000003851.1.76653 WP_000003851.1.76776 WP_000003851.1.76788 WP_000003851.1.76913 WP_000003851.1.76916 WP_000003851.1.76932 WP_000003851.1.76968 WP_000003851.1.76973 WP_000003851.1.76988 WP_000003851.1.77016 WP_000003851.1.77087 WP_000003851.1.77090 WP_000003851.1.77111 WP_000003851.1.77299 WP_000003851.1.77306 WP_000003851.1.77356 WP_000003851.1.77384 WP_000003851.1.77414 WP_000003851.1.77475 WP_000003851.1.77496 WP_000003851.1.77501 WP_000003851.1.77512 WP_000003851.1.77513 WP_000003851.1.77563 WP_000003851.1.77702 WP_000003851.1.77713 WP_000003851.1.7772 WP_000003851.1.77825 WP_000003851.1.77837 WP_000003851.1.77900 WP_000003851.1.7792 WP_000003851.1.77923 WP_000003851.1.7793 WP_000003851.1.77951 WP_000003851.1.77975 WP_000003851.1.77983 WP_000003851.1.77989 WP_000003851.1.7802 WP_000003851.1.78035 WP_000003851.1.78048 WP_000003851.1.78051 WP_000003851.1.78053 WP_000003851.1.78107 WP_000003851.1.78166 WP_000003851.1.78192 WP_000003851.1.78195 WP_000003851.1.78291 WP_000003851.1.78309 WP_000003851.1.78320 WP_000003851.1.78382 WP_000003851.1.78388 WP_000003851.1.78410 WP_000003851.1.78443 WP_000003851.1.78501 WP_000003851.1.78603 WP_000003851.1.7862 WP_000003851.1.78626 WP_000003851.1.78632 WP_000003851.1.78658 WP_000003851.1.78661 WP_000003851.1.78674 WP_000003851.1.78676 WP_000003851.1.78697 WP_000003851.1.78734 WP_000003851.1.78761 WP_000003851.1.7877 WP_000003851.1.78815 WP_000003851.1.78877 WP_000003851.1.78896 WP_000003851.1.789 WP_000003851.1.78993 WP_000003851.1.79012 WP_000003851.1.79069 WP_000003851.1.79074 WP_000003851.1.79098 WP_000003851.1.79099 WP_000003851.1.79155 WP_000003851.1.79164 WP_000003851.1.79204 WP_000003851.1.79280 WP_000003851.1.79397 WP_000003851.1.79456 WP_000003851.1.79468 WP_000003851.1.79532 WP_000003851.1.79547 WP_000003851.1.79580 WP_000003851.1.79586 WP_000003851.1.79654 WP_000003851.1.7970 WP_000003851.1.79722 WP_000003851.1.79772 WP_000003851.1.7979 WP_000003851.1.7982 WP_000003851.1.79880 WP_000003851.1.79916 WP_000003851.1.80065 WP_000003851.1.80103 WP_000003851.1.80249 WP_000003851.1.80254 WP_000003851.1.80282 WP_000003851.1.80354 WP_000003851.1.80368 WP_000003851.1.80380 WP_000003851.1.80386 WP_000003851.1.80400 WP_000003851.1.80462 WP_000003851.1.8049 WP_000003851.1.80492 WP_000003851.1.80569 WP_000003851.1.80664 WP_000003851.1.80696 WP_000003851.1.80760 WP_000003851.1.80874 WP_000003851.1.80876 WP_000003851.1.80984 WP_000003851.1.8106 WP_000003851.1.81109 WP_000003851.1.81110 WP_000003851.1.81131 WP_000003851.1.81187 WP_000003851.1.81197 WP_000003851.1.81225 WP_000003851.1.81262 WP_000003851.1.81268 WP_000003851.1.81269 WP_000003851.1.81271 WP_000003851.1.8130 WP_000003851.1.8131 WP_000003851.1.81333 WP_000003851.1.8134 WP_000003851.1.81342 WP_000003851.1.81364 WP_000003851.1.81388 WP_000003851.1.81494 WP_000003851.1.81557 WP_000003851.1.81668 WP_000003851.1.81676 WP_000003851.1.81681 WP_000003851.1.8170 WP_000003851.1.81763 WP_000003851.1.81768 WP_000003851.1.81855 WP_000003851.1.81921 WP_000003851.1.81931 WP_000003851.1.81936 WP_000003851.1.81949 WP_000003851.1.82070 WP_000003851.1.82076 WP_000003851.1.82131 WP_000003851.1.82156 WP_000003851.1.8218 WP_000003851.1.82180 WP_000003851.1.82201 WP_000003851.1.82214 WP_000003851.1.82225 WP_000003851.1.8240 WP_000003851.1.82401 WP_000003851.1.82408 WP_000003851.1.82416 WP_000003851.1.8242 WP_000003851.1.82420 WP_000003851.1.82434 WP_000003851.1.82456 WP_000003851.1.82465 WP_000003851.1.8247 WP_000003851.1.82473 WP_000003851.1.82474 WP_000003851.1.82529 WP_000003851.1.82553 WP_000003851.1.82569 WP_000003851.1.82646 WP_000003851.1.82670 WP_000003851.1.82731 WP_000003851.1.82812 WP_000003851.1.82850 WP_000003851.1.82872 WP_000003851.1.8294 WP_000003851.1.82959 WP_000003851.1.83005 WP_000003851.1.83006 WP_000003851.1.83007 WP_000003851.1.8304 WP_000003851.1.83180 WP_000003851.1.83204 WP_000003851.1.83229 WP_000003851.1.83235 WP_000003851.1.83290 WP_000003851.1.83331 WP_000003851.1.83354 WP_000003851.1.83356 WP_000003851.1.83558 WP_000003851.1.83657 WP_000003851.1.83677 WP_000003851.1.8375 WP_000003851.1.83923 WP_000003851.1.8399 WP_000003851.1.83994 WP_000003851.1.84 WP_000003851.1.84000 WP_000003851.1.84011 WP_000003851.1.8406 WP_000003851.1.84075 WP_000003851.1.84076 WP_000003851.1.84083 WP_000003851.1.84086 WP_000003851.1.84110 WP_000003851.1.84127 WP_000003851.1.84150 WP_000003851.1.84154 WP_000003851.1.84230 WP_000003851.1.84252 WP_000003851.1.84300 WP_000003851.1.8431 WP_000003851.1.84345 WP_000003851.1.84401 WP_000003851.1.84435 WP_000003851.1.84497 WP_000003851.1.84515 WP_000003851.1.84567 WP_000003851.1.84572 WP_000003851.1.84598 WP_000003851.1.84631 WP_000003851.1.84727 WP_000003851.1.84744 WP_000003851.1.84773 WP_000003851.1.84876 WP_000003851.1.84945 WP_000003851.1.84967 WP_000003851.1.84983 WP_000003851.1.85004 WP_000003851.1.8502 WP_000003851.1.85039 WP_000003851.1.85079 WP_000003851.1.85126 WP_000003851.1.8526 WP_000003851.1.85271 WP_000003851.1.85273 WP_000003851.1.85301 WP_000003851.1.85338 WP_000003851.1.85339 WP_000003851.1.85511 WP_000003851.1.85512 WP_000003851.1.8557 WP_000003851.1.85606 WP_000003851.1.85635 WP_000003851.1.85646 WP_000003851.1.85665 WP_000003851.1.85669 WP_000003851.1.85688 WP_000003851.1.85703 WP_000003851.1.85728 WP_000003851.1.85746 WP_000003851.1.85759 WP_000003851.1.85811 WP_000003851.1.859 WP_000003851.1.85917 WP_000003851.1.8594 WP_000003851.1.85977 WP_000003851.1.85982 WP_000003851.1.860 WP_000003851.1.8605 WP_000003851.1.86084 WP_000003851.1.8610 WP_000003851.1.86138 WP_000003851.1.8614 WP_000003851.1.86156 WP_000003851.1.86157 WP_000003851.1.8616 WP_000003851.1.86316 WP_000003851.1.86323 WP_000003851.1.86342 WP_000003851.1.86347 WP_000003851.1.86380 WP_000003851.1.8640 WP_000003851.1.8642 WP_000003851.1.86426 WP_000003851.1.8647 WP_000003851.1.86489 WP_000003851.1.86514 WP_000003851.1.86530 WP_000003851.1.86610 WP_000003851.1.86663 WP_000003851.1.86770 WP_000003851.1.86794 WP_000003851.1.86800 WP_000003851.1.86811 WP_000003851.1.86815 WP_000003851.1.86915 WP_000003851.1.86945 WP_000003851.1.86989 WP_000003851.1.87023 WP_000003851.1.87034 WP_000003851.1.87038 WP_000003851.1.87041 WP_000003851.1.87136 WP_000003851.1.87155 WP_000003851.1.87187 WP_000003851.1.87258 WP_000003851.1.87265 WP_000003851.1.87293 WP_000003851.1.87420 WP_000003851.1.87484 WP_000003851.1.87500 WP_000003851.1.87528 WP_000003851.1.87560 WP_000003851.1.87583 WP_000003851.1.8760 WP_000003851.1.87600 WP_000003851.1.87609 WP_000003851.1.87612 WP_000003851.1.87615 WP_000003851.1.87653 WP_000003851.1.87659 WP_000003851.1.87698 WP_000003851.1.87706 WP_000003851.1.87739 WP_000003851.1.87741 WP_000003851.1.87742 WP_000003851.1.87852 WP_000003851.1.87905 WP_000003851.1.87949 WP_000003851.1.88025 WP_000003851.1.88026 WP_000003851.1.8805 WP_000003851.1.88052 WP_000003851.1.8806 WP_000003851.1.881 WP_000003851.1.88145 WP_000003851.1.88185 WP_000003851.1.88199 WP_000003851.1.88275 WP_000003851.1.88299 WP_000003851.1.88313 WP_000003851.1.88356 WP_000003851.1.88359 WP_000003851.1.88407 WP_000003851.1.88414 WP_000003851.1.88444 WP_000003851.1.88446 WP_000003851.1.88458 WP_000003851.1.88474 WP_000003851.1.88501 WP_000003851.1.88508 WP_000003851.1.88538 WP_000003851.1.88547 WP_000003851.1.886 WP_000003851.1.88647 WP_000003851.1.88648 WP_000003851.1.88692 WP_000003851.1.88707 WP_000003851.1.88727 WP_000003851.1.88731 WP_000003851.1.88772 WP_000003851.1.88850 WP_000003851.1.88854 WP_000003851.1.8889 WP_000003851.1.88892 WP_000003851.1.88894 WP_000003851.1.88966 WP_000003851.1.88968 WP_000003851.1.88998 WP_000003851.1.89120 WP_000003851.1.89177 WP_000003851.1.89182 WP_000003851.1.89221 WP_000003851.1.89298 WP_000003851.1.89308 WP_000003851.1.89314 WP_000003851.1.89328 WP_000003851.1.89332 WP_000003851.1.89343 WP_000003851.1.89362 WP_000003851.1.89395 WP_000003851.1.8940 WP_000003851.1.89408 WP_000003851.1.89425 WP_000003851.1.89449 WP_000003851.1.8947 WP_000003851.1.89503 WP_000003851.1.89591 WP_000003851.1.89606 WP_000003851.1.8961 WP_000003851.1.89612 WP_000003851.1.89634 WP_000003851.1.89668 WP_000003851.1.89680 WP_000003851.1.89706 WP_000003851.1.89713 WP_000003851.1.89733 WP_000003851.1.89796 WP_000003851.1.89804 WP_000003851.1.89832 WP_000003851.1.89845 WP_000003851.1.89888 WP_000003851.1.89911 WP_000003851.1.8995 WP_000003851.1.89952 WP_000003851.1.90007 WP_000003851.1.9002 WP_000003851.1.9003 WP_000003851.1.9011 WP_000003851.1.90196 WP_000003851.1.90240 WP_000003851.1.90274 WP_000003851.1.90280 WP_000003851.1.90330 WP_000003851.1.90338 WP_000003851.1.90348 WP_000003851.1.90365 WP_000003851.1.90421 WP_000003851.1.90428 WP_000003851.1.90472 WP_000003851.1.90489 WP_000003851.1.90513 WP_000003851.1.90522 WP_000003851.1.90540 WP_000003851.1.90563 WP_000003851.1.90582 WP_000003851.1.90701 WP_000003851.1.90713 WP_000003851.1.90748 WP_000003851.1.90759 WP_000003851.1.90794 WP_000003851.1.90796 WP_000003851.1.90811 WP_000003851.1.90859 WP_000003851.1.9091 WP_000003851.1.90959 WP_000003851.1.90973 WP_000003851.1.91067 WP_000003851.1.91164 WP_000003851.1.91205 WP_000003851.1.91215 WP_000003851.1.91239 WP_000003851.1.91291 WP_000003851.1.91313 WP_000003851.1.9135 WP_000003851.1.9137 WP_000003851.1.91372 WP_000003851.1.91424 WP_000003851.1.91474 WP_000003851.1.91505 WP_000003851.1.91506 WP_000003851.1.91557 WP_000003851.1.91597 WP_000003851.1.91715 WP_000003851.1.91742 WP_000003851.1.91772 WP_000003851.1.91776 WP_000003851.1.91795 WP_000003851.1.9187 WP_000003851.1.91870 WP_000003851.1.91898 WP_000003851.1.91904 WP_000003851.1.91974 WP_000003851.1.92018 WP_000003851.1.92082 WP_000003851.1.92087 WP_000003851.1.92098 WP_000003851.1.92129 WP_000003851.1.92156 WP_000003851.1.92172 WP_000003851.1.9222 WP_000003851.1.92240 WP_000003851.1.92243 WP_000003851.1.92327 WP_000003851.1.92452 WP_000003851.1.92470 WP_000003851.1.92477 WP_000003851.1.92545 WP_000003851.1.92557 WP_000003851.1.92570 WP_000003851.1.92588 WP_000003851.1.926 WP_000003851.1.92628 WP_000003851.1.92633 WP_000003851.1.92649 WP_000003851.1.92676 WP_000003851.1.92705 WP_000003851.1.9271 WP_000003851.1.92734 WP_000003851.1.92806 WP_000003851.1.92810 WP_000003851.1.92823 WP_000003851.1.92890 WP_000003851.1.92929 WP_000003851.1.92987 WP_000003851.1.93007 WP_000003851.1.93022 WP_000003851.1.93076 WP_000003851.1.93103 WP_000003851.1.93105 WP_000003851.1.93111 WP_000003851.1.93121 WP_000003851.1.93168 WP_000003851.1.93184 WP_000003851.1.93215 WP_000003851.1.93221 WP_000003851.1.93223 WP_000003851.1.93239 WP_000003851.1.93302 WP_000003851.1.93350 WP_000003851.1.9336 WP_000003851.1.93387 WP_000003851.1.93469 WP_000003851.1.93511 WP_000003851.1.93512 WP_000003851.1.93524 WP_000003851.1.93577 WP_000003851.1.93635 WP_000003851.1.93657 WP_000003851.1.9374 WP_000003851.1.9375 WP_000003851.1.93754 WP_000003851.1.93780 WP_000003851.1.9380 WP_000003851.1.93809 WP_000003851.1.93828 WP_000003851.1.93842 WP_000003851.1.93843 WP_000003851.1.93875 WP_000003851.1.93909 WP_000003851.1.93919 WP_000003851.1.93938 WP_000003851.1.93984 WP_000003851.1.9399 WP_000003851.1.94017 WP_000003851.1.94079 WP_000003851.1.94097 WP_000003851.1.94107 WP_000003851.1.94142 WP_000003851.1.94215 WP_000003851.1.94303 WP_000003851.1.94365 WP_000003851.1.94390 WP_000003851.1.9440 WP_000003851.1.94415 WP_000003851.1.94473 WP_000003851.1.94492 WP_000003851.1.94510 WP_000003851.1.94527 WP_000003851.1.94573 WP_000003851.1.94579 WP_000003851.1.94586 WP_000003851.1.94593 WP_000003851.1.94598 WP_000003851.1.94649 WP_000003851.1.94650 WP_000003851.1.94659 WP_000003851.1.94662 WP_000003851.1.94670 WP_000003851.1.94700 WP_000003851.1.94745 WP_000003851.1.94782 WP_000003851.1.94815 WP_000003851.1.94817 WP_000003851.1.94820 WP_000003851.1.94835 WP_000003851.1.94850 WP_000003851.1.94851 WP_000003851.1.94864 WP_000003851.1.94952 WP_000003851.1.95006 WP_000003851.1.95055 WP_000003851.1.95076 WP_000003851.1.95099 WP_000003851.1.95136 WP_000003851.1.95165 WP_000003851.1.95239 WP_000003851.1.95246 WP_000003851.1.9525 WP_000003851.1.95255 WP_000003851.1.95265 WP_000003851.1.9527 WP_000003851.1.95338 WP_000003851.1.95412 WP_000003851.1.95434 WP_000003851.1.95447 WP_000003851.1.95456 WP_000003851.1.95530 WP_000003851.1.95547 WP_000003851.1.95590 WP_000003851.1.95607 WP_000003851.1.95625 WP_000003851.1.95656 WP_000003851.1.95675 WP_000003851.1.95716 WP_000003851.1.95757 WP_000003851.1.95776 WP_000003851.1.95866 WP_000003851.1.95884 WP_000003851.1.95890 WP_000003851.1.95906 WP_000003851.1.95963 WP_000003851.1.96025 WP_000003851.1.96044 WP_000003851.1.96054 WP_000003851.1.96094 WP_000003851.1.96107 WP_000003851.1.96127 WP_000003851.1.96144 WP_000003851.1.96188 WP_000003851.1.96211 WP_000003851.1.96212 WP_000003851.1.9624 WP_000003851.1.96319 WP_000003851.1.9633 WP_000003851.1.96340 WP_000003851.1.96348 WP_000003851.1.96349 WP_000003851.1.96359 WP_000003851.1.96380 WP_000003851.1.96521 WP_000003851.1.96537 WP_000003851.1.96539 WP_000003851.1.96552 WP_000003851.1.96588 WP_000003851.1.96610 WP_000003851.1.96625 WP_000003851.1.96635 WP_000003851.1.9664 WP_000003851.1.96675 WP_000003851.1.9670 WP_000003851.1.96735 WP_000003851.1.96750 WP_000003851.1.96792 WP_000003851.1.96801 WP_000003851.1.96803 WP_000003851.1.96876 WP_000003851.1.96925 WP_000003851.1.96938 WP_000003851.1.96946 WP_000003851.1.96957 WP_000003851.1.96978 WP_000003851.1.96993 WP_000003851.1.97028 WP_000003851.1.97079 WP_000003851.1.97103 WP_000003851.1.97154 WP_000003851.1.97184 WP_000003851.1.97287 WP_000003851.1.97291 WP_000003851.1.97322 WP_000003851.1.97328 WP_000003851.1.97422 WP_000003851.1.97441 WP_000003851.1.97497 WP_000003851.1.97505 WP_000003851.1.97547 WP_000003851.1.97599 WP_000003851.1.97606 WP_000003851.1.97615 WP_000003851.1.97646 WP_000003851.1.97648 WP_000003851.1.97656 WP_000003851.1.97690 WP_000003851.1.97704 WP_000003851.1.9774 WP_000003851.1.97800 WP_000003851.1.97819 WP_000003851.1.97840 WP_000003851.1.97907 WP_000003851.1.9793 WP_000003851.1.97938 WP_000003851.1.97981 WP_000003851.1.97986 WP_000003851.1.97991 WP_000003851.1.98036 WP_000003851.1.98080 WP_000003851.1.98086 WP_000003851.1.98119 WP_000003851.1.98158 WP_000003851.1.98263 WP_000003851.1.98314 WP_000003851.1.98338 WP_000003851.1.98418 WP_000003851.1.98440 WP_000003851.1.98448 WP_000003851.1.98457 WP_000003851.1.98472 WP_000003851.1.9850 WP_000003851.1.98502 WP_000003851.1.98570 WP_000003851.1.98607 WP_000003851.1.98726 WP_000003851.1.98731 WP_000003851.1.98762 WP_000003851.1.9877 WP_000003851.1.98801 WP_000003851.1.98818 WP_000003851.1.9899 WP_000003851.1.99057 WP_000003851.1.99097 WP_000003851.1.99163 WP_000003851.1.99164 WP_000003851.1.99215 WP_000003851.1.99335 WP_000003851.1.99350 WP_000003851.1.99360 WP_000003851.1.99363 WP_000003851.1.99388 WP_000003851.1.99397 WP_000003851.1.99456 WP_000003851.1.99463 WP_000003851.1.99483 WP_000003851.1.99490 WP_000003851.1.99493 WP_000003851.1.99546 WP_000003851.1.99579 WP_000003851.1.99595 WP_000003851.1.99613 WP_000003851.1.99630 WP_000003851.1.99676 WP_000003851.1.99764 WP_000003851.1.99829 WP_000003851.1.99837 WP_000003851.1.99841 WP_000003851.1.9992 WP_000003851.1.99924 WP_000003851.1.99961 WP_000003851.1.99996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]