SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488652938|ref|YP_007924741.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488652938|ref|YP_007924741.1|
Domain Number 1 Region: 4-320
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.93e-117
Family TK-like PP module 0.000000000434
Further Details:      
 
Domain Number 2 Region: 334-525
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.77e-67
Family TK-like Pyr module 0.0000000623
Further Details:      
 
Domain Number 3 Region: 532-664
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.25e-44
Family Transketolase C-terminal domain-like 0.00000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488652938|ref|YP_007924741.1|
Sequence length 666
Comment transketolase [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLKHNPTDPTWYDRDRFI
LSNSHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGYTPGVETTTGPLGQGLA
NAVGLAIAERTLGAQFNRPDHEIVDHYTYVFMGDGCLMEGISHEVCSLAGTLGLGKLIGF
YDHNGISIDGETEGWFTDDTAKRFEAYHWHVVHDIDGHAPEAVKKAILEAQSVKDKPSLI
ICRTVIGFGSPNKAGKEESHGAALGEEEVALTRQKLGWHHPAFEIPKEIYRAWDGREKGE
KAQQQWQEKFAAYEKAYPELAAEFTRRMSGGLPEAWESATQKFINDLQANPAKIATRKAS
QNTLNAYGPLLPELLGGSADLAPSNLTIWKGLTSLKEDPAGNYIHYGVREFGMTAIANGI
AHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVYTHDSIGLGEDGPTHQAMEQLAS
LRLTPNFSTWRPCDQVEAAVGWKLAIERQHGPTALILSRQNLAQVERTPEQVKAIARGGY
ILKDSGGKPDIILIATGSEMEITLQAAEKLTGEGHNVRVVSLPSTDIFDAQDEAYRESVL
PAHVTARVAVEAGIADYWYKYVGLKGAIIGMTGYGESAPADKLFPYFGFTVENIVEKARR
VLNIKG
Download sequence
Identical sequences Q8Z4S9
AE014613|CDS_461006-459006 AL513382|CDS_2543707-2545707 NP_457008.1.84458 WP_000087345.1.100008 WP_000087345.1.100036 WP_000087345.1.100079 WP_000087345.1.100196 WP_000087345.1.100284 WP_000087345.1.100313 WP_000087345.1.100314 WP_000087345.1.100321 WP_000087345.1.100354 WP_000087345.1.100421 WP_000087345.1.100446 WP_000087345.1.100450 WP_000087345.1.100732 WP_000087345.1.100733 WP_000087345.1.100739 WP_000087345.1.100764 WP_000087345.1.100799 WP_000087345.1.100941 WP_000087345.1.100953 WP_000087345.1.101011 WP_000087345.1.10108 WP_000087345.1.101226 WP_000087345.1.10124 WP_000087345.1.101271 WP_000087345.1.101312 WP_000087345.1.101322 WP_000087345.1.101374 WP_000087345.1.101616 WP_000087345.1.101890 WP_000087345.1.101941 WP_000087345.1.102050 WP_000087345.1.102087 WP_000087345.1.1038 WP_000087345.1.104 WP_000087345.1.10401 WP_000087345.1.10428 WP_000087345.1.10459 WP_000087345.1.10475 WP_000087345.1.10511 WP_000087345.1.10514 WP_000087345.1.10530 WP_000087345.1.10532 WP_000087345.1.10547 WP_000087345.1.10595 WP_000087345.1.10642 WP_000087345.1.10654 WP_000087345.1.10677 WP_000087345.1.10857 WP_000087345.1.10926 WP_000087345.1.10936 WP_000087345.1.11012 WP_000087345.1.11055 WP_000087345.1.11126 WP_000087345.1.11142 WP_000087345.1.11239 WP_000087345.1.11253 WP_000087345.1.11314 WP_000087345.1.11385 WP_000087345.1.1142 WP_000087345.1.11426 WP_000087345.1.11429 WP_000087345.1.11557 WP_000087345.1.11567 WP_000087345.1.11638 WP_000087345.1.11883 WP_000087345.1.11908 WP_000087345.1.11914 WP_000087345.1.12040 WP_000087345.1.12061 WP_000087345.1.1207 WP_000087345.1.12141 WP_000087345.1.12172 WP_000087345.1.12192 WP_000087345.1.1224 WP_000087345.1.12364 WP_000087345.1.12398 WP_000087345.1.12441 WP_000087345.1.12581 WP_000087345.1.12620 WP_000087345.1.12648 WP_000087345.1.12683 WP_000087345.1.12726 WP_000087345.1.12727 WP_000087345.1.12741 WP_000087345.1.12834 WP_000087345.1.13108 WP_000087345.1.13161 WP_000087345.1.1321 WP_000087345.1.13268 WP_000087345.1.13291 WP_000087345.1.133 WP_000087345.1.13314 WP_000087345.1.13338 WP_000087345.1.13342 WP_000087345.1.13352 WP_000087345.1.13406 WP_000087345.1.13440 WP_000087345.1.13443 WP_000087345.1.13599 WP_000087345.1.13686 WP_000087345.1.1372 WP_000087345.1.13732 WP_000087345.1.1382 WP_000087345.1.1397 WP_000087345.1.13972 WP_000087345.1.140 WP_000087345.1.1401 WP_000087345.1.1408 WP_000087345.1.14089 WP_000087345.1.14099 WP_000087345.1.14120 WP_000087345.1.14123 WP_000087345.1.14150 WP_000087345.1.14191 WP_000087345.1.14197 WP_000087345.1.14280 WP_000087345.1.14333 WP_000087345.1.14399 WP_000087345.1.14444 WP_000087345.1.14467 WP_000087345.1.14474 WP_000087345.1.14500 WP_000087345.1.14526 WP_000087345.1.14550 WP_000087345.1.14575 WP_000087345.1.14701 WP_000087345.1.14703 WP_000087345.1.14719 WP_000087345.1.1473 WP_000087345.1.14765 WP_000087345.1.14810 WP_000087345.1.14894 WP_000087345.1.14930 WP_000087345.1.14947 WP_000087345.1.14948 WP_000087345.1.15184 WP_000087345.1.15244 WP_000087345.1.15265 WP_000087345.1.15362 WP_000087345.1.15415 WP_000087345.1.15423 WP_000087345.1.15433 WP_000087345.1.15439 WP_000087345.1.15487 WP_000087345.1.15535 WP_000087345.1.15581 WP_000087345.1.15597 WP_000087345.1.15710 WP_000087345.1.15717 WP_000087345.1.15905 WP_000087345.1.15912 WP_000087345.1.15970 WP_000087345.1.16046 WP_000087345.1.16051 WP_000087345.1.16058 WP_000087345.1.16150 WP_000087345.1.16155 WP_000087345.1.1626 WP_000087345.1.16264 WP_000087345.1.16344 WP_000087345.1.16452 WP_000087345.1.16461 WP_000087345.1.16462 WP_000087345.1.16465 WP_000087345.1.16522 WP_000087345.1.16588 WP_000087345.1.16658 WP_000087345.1.16666 WP_000087345.1.16673 WP_000087345.1.1674 WP_000087345.1.16767 WP_000087345.1.16781 WP_000087345.1.16879 WP_000087345.1.16893 WP_000087345.1.16905 WP_000087345.1.16948 WP_000087345.1.17049 WP_000087345.1.17058 WP_000087345.1.17078 WP_000087345.1.17219 WP_000087345.1.1722 WP_000087345.1.17302 WP_000087345.1.17308 WP_000087345.1.17368 WP_000087345.1.17405 WP_000087345.1.17406 WP_000087345.1.17513 WP_000087345.1.17543 WP_000087345.1.17563 WP_000087345.1.17578 WP_000087345.1.17622 WP_000087345.1.17659 WP_000087345.1.17667 WP_000087345.1.17686 WP_000087345.1.17741 WP_000087345.1.17840 WP_000087345.1.17956 WP_000087345.1.18005 WP_000087345.1.1801 WP_000087345.1.18021 WP_000087345.1.18099 WP_000087345.1.18124 WP_000087345.1.18144 WP_000087345.1.18280 WP_000087345.1.18328 WP_000087345.1.18358 WP_000087345.1.18370 WP_000087345.1.18406 WP_000087345.1.18474 WP_000087345.1.18513 WP_000087345.1.18610 WP_000087345.1.18678 WP_000087345.1.18722 WP_000087345.1.18766 WP_000087345.1.1880 WP_000087345.1.1885 WP_000087345.1.18860 WP_000087345.1.18922 WP_000087345.1.18959 WP_000087345.1.19001 WP_000087345.1.19006 WP_000087345.1.19044 WP_000087345.1.19084 WP_000087345.1.19187 WP_000087345.1.19228 WP_000087345.1.19288 WP_000087345.1.19300 WP_000087345.1.19422 WP_000087345.1.19454 WP_000087345.1.19456 WP_000087345.1.19496 WP_000087345.1.19535 WP_000087345.1.19538 WP_000087345.1.19589 WP_000087345.1.19663 WP_000087345.1.19686 WP_000087345.1.19731 WP_000087345.1.19794 WP_000087345.1.1992 WP_000087345.1.19999 WP_000087345.1.20254 WP_000087345.1.20255 WP_000087345.1.20296 WP_000087345.1.20339 WP_000087345.1.20419 WP_000087345.1.20465 WP_000087345.1.20492 WP_000087345.1.2053 WP_000087345.1.20635 WP_000087345.1.20718 WP_000087345.1.2073 WP_000087345.1.20740 WP_000087345.1.2087 WP_000087345.1.20883 WP_000087345.1.20947 WP_000087345.1.20953 WP_000087345.1.21010 WP_000087345.1.2106 WP_000087345.1.21062 WP_000087345.1.21144 WP_000087345.1.21162 WP_000087345.1.21184 WP_000087345.1.21185 WP_000087345.1.21366 WP_000087345.1.21492 WP_000087345.1.2166 WP_000087345.1.21674 WP_000087345.1.21946 WP_000087345.1.21966 WP_000087345.1.22064 WP_000087345.1.22118 WP_000087345.1.22126 WP_000087345.1.2216 WP_000087345.1.22208 WP_000087345.1.2227 WP_000087345.1.22373 WP_000087345.1.22476 WP_000087345.1.22614 WP_000087345.1.22683 WP_000087345.1.2284 WP_000087345.1.22895 WP_000087345.1.22926 WP_000087345.1.22943 WP_000087345.1.22967 WP_000087345.1.23040 WP_000087345.1.23058 WP_000087345.1.23218 WP_000087345.1.2331 WP_000087345.1.2332 WP_000087345.1.23340 WP_000087345.1.2336 WP_000087345.1.23365 WP_000087345.1.23412 WP_000087345.1.23426 WP_000087345.1.23515 WP_000087345.1.23548 WP_000087345.1.23571 WP_000087345.1.23604 WP_000087345.1.23679 WP_000087345.1.23728 WP_000087345.1.2375 WP_000087345.1.23783 WP_000087345.1.23786 WP_000087345.1.23787 WP_000087345.1.23801 WP_000087345.1.24028 WP_000087345.1.24061 WP_000087345.1.24083 WP_000087345.1.24117 WP_000087345.1.24125 WP_000087345.1.24138 WP_000087345.1.24153 WP_000087345.1.24291 WP_000087345.1.24322 WP_000087345.1.24355 WP_000087345.1.24375 WP_000087345.1.24400 WP_000087345.1.24619 WP_000087345.1.24643 WP_000087345.1.24688 WP_000087345.1.24716 WP_000087345.1.2481 WP_000087345.1.24832 WP_000087345.1.24964 WP_000087345.1.25017 WP_000087345.1.25032 WP_000087345.1.25041 WP_000087345.1.25053 WP_000087345.1.25140 WP_000087345.1.25185 WP_000087345.1.25196 WP_000087345.1.25210 WP_000087345.1.25219 WP_000087345.1.25304 WP_000087345.1.25374 WP_000087345.1.25475 WP_000087345.1.25490 WP_000087345.1.25508 WP_000087345.1.25512 WP_000087345.1.25603 WP_000087345.1.2562 WP_000087345.1.25666 WP_000087345.1.25807 WP_000087345.1.25821 WP_000087345.1.25833 WP_000087345.1.25835 WP_000087345.1.25882 WP_000087345.1.25911 WP_000087345.1.25962 WP_000087345.1.25963 WP_000087345.1.26001 WP_000087345.1.26027 WP_000087345.1.26107 WP_000087345.1.2615 WP_000087345.1.26217 WP_000087345.1.26230 WP_000087345.1.26232 WP_000087345.1.26272 WP_000087345.1.26286 WP_000087345.1.26288 WP_000087345.1.26394 WP_000087345.1.26491 WP_000087345.1.2654 WP_000087345.1.26554 WP_000087345.1.26636 WP_000087345.1.26689 WP_000087345.1.2679 WP_000087345.1.26908 WP_000087345.1.2692 WP_000087345.1.26928 WP_000087345.1.270 WP_000087345.1.27008 WP_000087345.1.27027 WP_000087345.1.27070 WP_000087345.1.27077 WP_000087345.1.27086 WP_000087345.1.27087 WP_000087345.1.27111 WP_000087345.1.27115 WP_000087345.1.2713 WP_000087345.1.2717 WP_000087345.1.27228 WP_000087345.1.27282 WP_000087345.1.27285 WP_000087345.1.27309 WP_000087345.1.27329 WP_000087345.1.27361 WP_000087345.1.27595 WP_000087345.1.27598 WP_000087345.1.27706 WP_000087345.1.27775 WP_000087345.1.27785 WP_000087345.1.27900 WP_000087345.1.27928 WP_000087345.1.27945 WP_000087345.1.28004 WP_000087345.1.2809 WP_000087345.1.28155 WP_000087345.1.28198 WP_000087345.1.2822 WP_000087345.1.28229 WP_000087345.1.28384 WP_000087345.1.28386 WP_000087345.1.28395 WP_000087345.1.284 WP_000087345.1.2845 WP_000087345.1.28479 WP_000087345.1.28627 WP_000087345.1.28692 WP_000087345.1.2873 WP_000087345.1.28917 WP_000087345.1.28962 WP_000087345.1.29023 WP_000087345.1.29042 WP_000087345.1.2905 WP_000087345.1.2907 WP_000087345.1.29081 WP_000087345.1.29089 WP_000087345.1.29153 WP_000087345.1.29203 WP_000087345.1.29237 WP_000087345.1.29248 WP_000087345.1.29288 WP_000087345.1.29389 WP_000087345.1.29439 WP_000087345.1.2946 WP_000087345.1.29462 WP_000087345.1.29563 WP_000087345.1.29727 WP_000087345.1.29743 WP_000087345.1.29782 WP_000087345.1.29833 WP_000087345.1.29851 WP_000087345.1.29865 WP_000087345.1.29886 WP_000087345.1.29919 WP_000087345.1.2994 WP_000087345.1.29964 WP_000087345.1.29983 WP_000087345.1.30009 WP_000087345.1.30013 WP_000087345.1.3002 WP_000087345.1.30034 WP_000087345.1.30049 WP_000087345.1.30058 WP_000087345.1.30172 WP_000087345.1.30185 WP_000087345.1.30354 WP_000087345.1.30362 WP_000087345.1.3042 WP_000087345.1.30421 WP_000087345.1.30440 WP_000087345.1.30448 WP_000087345.1.30489 WP_000087345.1.30517 WP_000087345.1.30542 WP_000087345.1.30544 WP_000087345.1.30556 WP_000087345.1.30572 WP_000087345.1.30585 WP_000087345.1.30618 WP_000087345.1.30664 WP_000087345.1.30688 WP_000087345.1.30806 WP_000087345.1.30967 WP_000087345.1.31046 WP_000087345.1.31066 WP_000087345.1.31078 WP_000087345.1.31139 WP_000087345.1.31145 WP_000087345.1.31182 WP_000087345.1.31205 WP_000087345.1.3121 WP_000087345.1.31223 WP_000087345.1.31303 WP_000087345.1.3131 WP_000087345.1.31352 WP_000087345.1.31389 WP_000087345.1.31413 WP_000087345.1.31446 WP_000087345.1.31533 WP_000087345.1.31799 WP_000087345.1.31836 WP_000087345.1.32041 WP_000087345.1.32042 WP_000087345.1.3207 WP_000087345.1.32189 WP_000087345.1.32202 WP_000087345.1.32293 WP_000087345.1.32299 WP_000087345.1.32422 WP_000087345.1.32425 WP_000087345.1.32458 WP_000087345.1.32529 WP_000087345.1.32563 WP_000087345.1.32578 WP_000087345.1.32617 WP_000087345.1.3270 WP_000087345.1.32725 WP_000087345.1.32838 WP_000087345.1.32848 WP_000087345.1.32868 WP_000087345.1.3290 WP_000087345.1.32940 WP_000087345.1.32941 WP_000087345.1.3296 WP_000087345.1.32966 WP_000087345.1.32985 WP_000087345.1.33037 WP_000087345.1.3305 WP_000087345.1.33051 WP_000087345.1.33065 WP_000087345.1.33122 WP_000087345.1.3315 WP_000087345.1.33208 WP_000087345.1.33214 WP_000087345.1.33247 WP_000087345.1.33280 WP_000087345.1.33283 WP_000087345.1.33313 WP_000087345.1.33339 WP_000087345.1.33382 WP_000087345.1.33490 WP_000087345.1.33501 WP_000087345.1.33529 WP_000087345.1.33689 WP_000087345.1.3370 WP_000087345.1.33730 WP_000087345.1.33741 WP_000087345.1.33840 WP_000087345.1.3392 WP_000087345.1.33926 WP_000087345.1.33957 WP_000087345.1.33969 WP_000087345.1.34001 WP_000087345.1.34059 WP_000087345.1.34118 WP_000087345.1.34211 WP_000087345.1.34214 WP_000087345.1.34234 WP_000087345.1.34284 WP_000087345.1.34376 WP_000087345.1.34382 WP_000087345.1.34484 WP_000087345.1.34517 WP_000087345.1.34530 WP_000087345.1.34665 WP_000087345.1.34694 WP_000087345.1.34751 WP_000087345.1.34808 WP_000087345.1.34824 WP_000087345.1.34834 WP_000087345.1.34932 WP_000087345.1.34962 WP_000087345.1.35001 WP_000087345.1.35040 WP_000087345.1.35074 WP_000087345.1.35175 WP_000087345.1.35240 WP_000087345.1.35274 WP_000087345.1.35532 WP_000087345.1.35560 WP_000087345.1.3557 WP_000087345.1.35628 WP_000087345.1.3570 WP_000087345.1.35712 WP_000087345.1.35713 WP_000087345.1.35736 WP_000087345.1.35791 WP_000087345.1.35795 WP_000087345.1.35870 WP_000087345.1.35916 WP_000087345.1.35938 WP_000087345.1.35966 WP_000087345.1.36000 WP_000087345.1.36034 WP_000087345.1.36036 WP_000087345.1.36069 WP_000087345.1.36291 WP_000087345.1.36298 WP_000087345.1.36308 WP_000087345.1.36323 WP_000087345.1.36343 WP_000087345.1.36460 WP_000087345.1.3649 WP_000087345.1.36495 WP_000087345.1.36526 WP_000087345.1.36567 WP_000087345.1.36579 WP_000087345.1.36617 WP_000087345.1.36618 WP_000087345.1.36643 WP_000087345.1.36663 WP_000087345.1.36701 WP_000087345.1.36725 WP_000087345.1.36779 WP_000087345.1.36798 WP_000087345.1.36802 WP_000087345.1.36821 WP_000087345.1.36853 WP_000087345.1.36950 WP_000087345.1.37014 WP_000087345.1.37133 WP_000087345.1.37176 WP_000087345.1.37199 WP_000087345.1.37200 WP_000087345.1.37258 WP_000087345.1.37303 WP_000087345.1.37513 WP_000087345.1.37584 WP_000087345.1.37590 WP_000087345.1.37593 WP_000087345.1.37600 WP_000087345.1.37613 WP_000087345.1.37659 WP_000087345.1.37662 WP_000087345.1.37691 WP_000087345.1.37761 WP_000087345.1.37775 WP_000087345.1.37777 WP_000087345.1.378 WP_000087345.1.379 WP_000087345.1.37911 WP_000087345.1.37941 WP_000087345.1.37985 WP_000087345.1.38061 WP_000087345.1.38064 WP_000087345.1.38108 WP_000087345.1.3816 WP_000087345.1.38207 WP_000087345.1.38261 WP_000087345.1.38266 WP_000087345.1.38310 WP_000087345.1.3834 WP_000087345.1.38351 WP_000087345.1.3838 WP_000087345.1.38381 WP_000087345.1.38440 WP_000087345.1.38486 WP_000087345.1.38515 WP_000087345.1.38595 WP_000087345.1.3860 WP_000087345.1.38642 WP_000087345.1.38734 WP_000087345.1.38877 WP_000087345.1.38983 WP_000087345.1.38996 WP_000087345.1.39056 WP_000087345.1.3907 WP_000087345.1.39105 WP_000087345.1.3914 WP_000087345.1.39147 WP_000087345.1.39161 WP_000087345.1.39210 WP_000087345.1.39235 WP_000087345.1.3931 WP_000087345.1.39435 WP_000087345.1.39502 WP_000087345.1.39530 WP_000087345.1.39619 WP_000087345.1.39620 WP_000087345.1.39624 WP_000087345.1.39659 WP_000087345.1.39667 WP_000087345.1.39775 WP_000087345.1.39879 WP_000087345.1.39890 WP_000087345.1.39941 WP_000087345.1.39945 WP_000087345.1.39947 WP_000087345.1.40095 WP_000087345.1.40097 WP_000087345.1.401 WP_000087345.1.40160 WP_000087345.1.40167 WP_000087345.1.40279 WP_000087345.1.4042 WP_000087345.1.40467 WP_000087345.1.40496 WP_000087345.1.40517 WP_000087345.1.40698 WP_000087345.1.40750 WP_000087345.1.40763 WP_000087345.1.40854 WP_000087345.1.4089 WP_000087345.1.40924 WP_000087345.1.40932 WP_000087345.1.40946 WP_000087345.1.41004 WP_000087345.1.4106 WP_000087345.1.41070 WP_000087345.1.41074 WP_000087345.1.41075 WP_000087345.1.41097 WP_000087345.1.41132 WP_000087345.1.41176 WP_000087345.1.41251 WP_000087345.1.41258 WP_000087345.1.41305 WP_000087345.1.41321 WP_000087345.1.41333 WP_000087345.1.41335 WP_000087345.1.4136 WP_000087345.1.41415 WP_000087345.1.41459 WP_000087345.1.41498 WP_000087345.1.41519 WP_000087345.1.41524 WP_000087345.1.41631 WP_000087345.1.41658 WP_000087345.1.41659 WP_000087345.1.41716 WP_000087345.1.41746 WP_000087345.1.41824 WP_000087345.1.41825 WP_000087345.1.41836 WP_000087345.1.41894 WP_000087345.1.41919 WP_000087345.1.41929 WP_000087345.1.4194 WP_000087345.1.42069 WP_000087345.1.42081 WP_000087345.1.42090 WP_000087345.1.42111 WP_000087345.1.42187 WP_000087345.1.42200 WP_000087345.1.42219 WP_000087345.1.42257 WP_000087345.1.42261 WP_000087345.1.42349 WP_000087345.1.42364 WP_000087345.1.42371 WP_000087345.1.42379 WP_000087345.1.42391 WP_000087345.1.42399 WP_000087345.1.42539 WP_000087345.1.42603 WP_000087345.1.42650 WP_000087345.1.4267 WP_000087345.1.42701 WP_000087345.1.42805 WP_000087345.1.42815 WP_000087345.1.42859 WP_000087345.1.4298 WP_000087345.1.43008 WP_000087345.1.43016 WP_000087345.1.43019 WP_000087345.1.43065 WP_000087345.1.43068 WP_000087345.1.43069 WP_000087345.1.43128 WP_000087345.1.43141 WP_000087345.1.43157 WP_000087345.1.43161 WP_000087345.1.43190 WP_000087345.1.43198 WP_000087345.1.43290 WP_000087345.1.43292 WP_000087345.1.43307 WP_000087345.1.43513 WP_000087345.1.43633 WP_000087345.1.43637 WP_000087345.1.43651 WP_000087345.1.43722 WP_000087345.1.43801 WP_000087345.1.43812 WP_000087345.1.43878 WP_000087345.1.43888 WP_000087345.1.43919 WP_000087345.1.43974 WP_000087345.1.44049 WP_000087345.1.44101 WP_000087345.1.44160 WP_000087345.1.44180 WP_000087345.1.44196 WP_000087345.1.44248 WP_000087345.1.44262 WP_000087345.1.44268 WP_000087345.1.4427 WP_000087345.1.44296 WP_000087345.1.44343 WP_000087345.1.44351 WP_000087345.1.44360 WP_000087345.1.44416 WP_000087345.1.44431 WP_000087345.1.44437 WP_000087345.1.44546 WP_000087345.1.4468 WP_000087345.1.44762 WP_000087345.1.44815 WP_000087345.1.44828 WP_000087345.1.44879 WP_000087345.1.44917 WP_000087345.1.4501 WP_000087345.1.45072 WP_000087345.1.45093 WP_000087345.1.45136 WP_000087345.1.45241 WP_000087345.1.45435 WP_000087345.1.45523 WP_000087345.1.45596 WP_000087345.1.45648 WP_000087345.1.45829 WP_000087345.1.45871 WP_000087345.1.46030 WP_000087345.1.46077 WP_000087345.1.46169 WP_000087345.1.46225 WP_000087345.1.46241 WP_000087345.1.46307 WP_000087345.1.46355 WP_000087345.1.464 WP_000087345.1.46454 WP_000087345.1.46461 WP_000087345.1.46504 WP_000087345.1.46505 WP_000087345.1.46551 WP_000087345.1.46559 WP_000087345.1.46701 WP_000087345.1.46781 WP_000087345.1.46816 WP_000087345.1.46842 WP_000087345.1.4690 WP_000087345.1.46920 WP_000087345.1.46945 WP_000087345.1.47036 WP_000087345.1.47037 WP_000087345.1.47042 WP_000087345.1.47059 WP_000087345.1.47085 WP_000087345.1.47123 WP_000087345.1.47215 WP_000087345.1.47245 WP_000087345.1.47523 WP_000087345.1.47531 WP_000087345.1.47532 WP_000087345.1.47605 WP_000087345.1.47630 WP_000087345.1.4774 WP_000087345.1.47756 WP_000087345.1.4781 WP_000087345.1.47886 WP_000087345.1.47898 WP_000087345.1.48019 WP_000087345.1.48100 WP_000087345.1.48114 WP_000087345.1.48139 WP_000087345.1.48190 WP_000087345.1.48292 WP_000087345.1.48324 WP_000087345.1.48426 WP_000087345.1.48430 WP_000087345.1.48436 WP_000087345.1.48586 WP_000087345.1.4859 WP_000087345.1.48591 WP_000087345.1.48610 WP_000087345.1.48631 WP_000087345.1.48663 WP_000087345.1.48690 WP_000087345.1.48734 WP_000087345.1.48756 WP_000087345.1.48778 WP_000087345.1.48849 WP_000087345.1.48955 WP_000087345.1.48963 WP_000087345.1.48973 WP_000087345.1.49004 WP_000087345.1.49106 WP_000087345.1.49117 WP_000087345.1.49121 WP_000087345.1.4914 WP_000087345.1.49140 WP_000087345.1.49153 WP_000087345.1.49166 WP_000087345.1.49355 WP_000087345.1.49429 WP_000087345.1.49434 WP_000087345.1.49450 WP_000087345.1.495 WP_000087345.1.49545 WP_000087345.1.49769 WP_000087345.1.49846 WP_000087345.1.4991 WP_000087345.1.49947 WP_000087345.1.49959 WP_000087345.1.49997 WP_000087345.1.50014 WP_000087345.1.50030 WP_000087345.1.50043 WP_000087345.1.50103 WP_000087345.1.50158 WP_000087345.1.50247 WP_000087345.1.50308 WP_000087345.1.50309 WP_000087345.1.50387 WP_000087345.1.50406 WP_000087345.1.50468 WP_000087345.1.5051 WP_000087345.1.50566 WP_000087345.1.50570 WP_000087345.1.50626 WP_000087345.1.50726 WP_000087345.1.50771 WP_000087345.1.50875 WP_000087345.1.50885 WP_000087345.1.509 WP_000087345.1.50929 WP_000087345.1.50970 WP_000087345.1.51040 WP_000087345.1.51048 WP_000087345.1.51100 WP_000087345.1.51134 WP_000087345.1.51227 WP_000087345.1.5127 WP_000087345.1.51305 WP_000087345.1.51315 WP_000087345.1.5136 WP_000087345.1.51474 WP_000087345.1.51519 WP_000087345.1.51598 WP_000087345.1.51644 WP_000087345.1.51724 WP_000087345.1.51734 WP_000087345.1.51838 WP_000087345.1.51863 WP_000087345.1.51935 WP_000087345.1.52057 WP_000087345.1.52114 WP_000087345.1.52129 WP_000087345.1.52191 WP_000087345.1.52202 WP_000087345.1.52209 WP_000087345.1.52339 WP_000087345.1.52469 WP_000087345.1.52571 WP_000087345.1.526 WP_000087345.1.52647 WP_000087345.1.52742 WP_000087345.1.52773 WP_000087345.1.52795 WP_000087345.1.52807 WP_000087345.1.52887 WP_000087345.1.53092 WP_000087345.1.53141 WP_000087345.1.53151 WP_000087345.1.53154 WP_000087345.1.53159 WP_000087345.1.53210 WP_000087345.1.53233 WP_000087345.1.53307 WP_000087345.1.53321 WP_000087345.1.53368 WP_000087345.1.53450 WP_000087345.1.5349 WP_000087345.1.53540 WP_000087345.1.53555 WP_000087345.1.53559 WP_000087345.1.5356 WP_000087345.1.53571 WP_000087345.1.5358 WP_000087345.1.53692 WP_000087345.1.53723 WP_000087345.1.5374 WP_000087345.1.53750 WP_000087345.1.53815 WP_000087345.1.53839 WP_000087345.1.53892 WP_000087345.1.53898 WP_000087345.1.53902 WP_000087345.1.53958 WP_000087345.1.53981 WP_000087345.1.53984 WP_000087345.1.54132 WP_000087345.1.54170 WP_000087345.1.54175 WP_000087345.1.54203 WP_000087345.1.54259 WP_000087345.1.5430 WP_000087345.1.54371 WP_000087345.1.54431 WP_000087345.1.54442 WP_000087345.1.54482 WP_000087345.1.54589 WP_000087345.1.54667 WP_000087345.1.54678 WP_000087345.1.54681 WP_000087345.1.54748 WP_000087345.1.5481 WP_000087345.1.54865 WP_000087345.1.54935 WP_000087345.1.54979 WP_000087345.1.55010 WP_000087345.1.55034 WP_000087345.1.55163 WP_000087345.1.55165 WP_000087345.1.55215 WP_000087345.1.55290 WP_000087345.1.55310 WP_000087345.1.55317 WP_000087345.1.55379 WP_000087345.1.5539 WP_000087345.1.55468 WP_000087345.1.55506 WP_000087345.1.55604 WP_000087345.1.55639 WP_000087345.1.55699 WP_000087345.1.55725 WP_000087345.1.55780 WP_000087345.1.55967 WP_000087345.1.56144 WP_000087345.1.56172 WP_000087345.1.5621 WP_000087345.1.56226 WP_000087345.1.56311 WP_000087345.1.56419 WP_000087345.1.56423 WP_000087345.1.56514 WP_000087345.1.56535 WP_000087345.1.56585 WP_000087345.1.56640 WP_000087345.1.56724 WP_000087345.1.56825 WP_000087345.1.56887 WP_000087345.1.56889 WP_000087345.1.56981 WP_000087345.1.57101 WP_000087345.1.57137 WP_000087345.1.57179 WP_000087345.1.57342 WP_000087345.1.57684 WP_000087345.1.57699 WP_000087345.1.57785 WP_000087345.1.57873 WP_000087345.1.57965 WP_000087345.1.57972 WP_000087345.1.58008 WP_000087345.1.58044 WP_000087345.1.58081 WP_000087345.1.5809 WP_000087345.1.58132 WP_000087345.1.58173 WP_000087345.1.58191 WP_000087345.1.58194 WP_000087345.1.58252 WP_000087345.1.58261 WP_000087345.1.58274 WP_000087345.1.58282 WP_000087345.1.58324 WP_000087345.1.58326 WP_000087345.1.5836 WP_000087345.1.58485 WP_000087345.1.58537 WP_000087345.1.58583 WP_000087345.1.58652 WP_000087345.1.58663 WP_000087345.1.58724 WP_000087345.1.5875 WP_000087345.1.58796 WP_000087345.1.58847 WP_000087345.1.58883 WP_000087345.1.58898 WP_000087345.1.58949 WP_000087345.1.58970 WP_000087345.1.58974 WP_000087345.1.59020 WP_000087345.1.59043 WP_000087345.1.59056 WP_000087345.1.59061 WP_000087345.1.59064 WP_000087345.1.59282 WP_000087345.1.59299 WP_000087345.1.59313 WP_000087345.1.5949 WP_000087345.1.59501 WP_000087345.1.59510 WP_000087345.1.5969 WP_000087345.1.59751 WP_000087345.1.59827 WP_000087345.1.59829 WP_000087345.1.59847 WP_000087345.1.59863 WP_000087345.1.59994 WP_000087345.1.60045 WP_000087345.1.60076 WP_000087345.1.60114 WP_000087345.1.60154 WP_000087345.1.60168 WP_000087345.1.60192 WP_000087345.1.60199 WP_000087345.1.60212 WP_000087345.1.60253 WP_000087345.1.60322 WP_000087345.1.60324 WP_000087345.1.60356 WP_000087345.1.6038 WP_000087345.1.60380 WP_000087345.1.6041 WP_000087345.1.60424 WP_000087345.1.60481 WP_000087345.1.605 WP_000087345.1.6058 WP_000087345.1.60584 WP_000087345.1.6060 WP_000087345.1.60676 WP_000087345.1.60708 WP_000087345.1.60725 WP_000087345.1.60783 WP_000087345.1.60792 WP_000087345.1.60807 WP_000087345.1.60882 WP_000087345.1.60889 WP_000087345.1.60950 WP_000087345.1.6104 WP_000087345.1.61044 WP_000087345.1.61076 WP_000087345.1.61123 WP_000087345.1.61147 WP_000087345.1.61168 WP_000087345.1.61210 WP_000087345.1.61511 WP_000087345.1.61539 WP_000087345.1.61542 WP_000087345.1.61553 WP_000087345.1.61649 WP_000087345.1.61652 WP_000087345.1.61697 WP_000087345.1.61809 WP_000087345.1.61877 WP_000087345.1.61920 WP_000087345.1.62124 WP_000087345.1.62199 WP_000087345.1.62223 WP_000087345.1.62302 WP_000087345.1.62314 WP_000087345.1.62323 WP_000087345.1.62333 WP_000087345.1.62338 WP_000087345.1.62380 WP_000087345.1.62411 WP_000087345.1.62436 WP_000087345.1.62475 WP_000087345.1.62536 WP_000087345.1.62640 WP_000087345.1.62686 WP_000087345.1.62751 WP_000087345.1.62825 WP_000087345.1.62913 WP_000087345.1.62932 WP_000087345.1.62960 WP_000087345.1.63016 WP_000087345.1.63025 WP_000087345.1.63069 WP_000087345.1.63087 WP_000087345.1.63169 WP_000087345.1.63297 WP_000087345.1.63448 WP_000087345.1.63514 WP_000087345.1.63583 WP_000087345.1.63592 WP_000087345.1.63663 WP_000087345.1.63736 WP_000087345.1.63816 WP_000087345.1.63876 WP_000087345.1.6389 WP_000087345.1.63901 WP_000087345.1.63955 WP_000087345.1.63963 WP_000087345.1.64032 WP_000087345.1.64087 WP_000087345.1.6415 WP_000087345.1.64293 WP_000087345.1.64332 WP_000087345.1.64376 WP_000087345.1.644 WP_000087345.1.64471 WP_000087345.1.64501 WP_000087345.1.64538 WP_000087345.1.64632 WP_000087345.1.64648 WP_000087345.1.64654 WP_000087345.1.64662 WP_000087345.1.64663 WP_000087345.1.64709 WP_000087345.1.64710 WP_000087345.1.64744 WP_000087345.1.64763 WP_000087345.1.64817 WP_000087345.1.64847 WP_000087345.1.6487 WP_000087345.1.64891 WP_000087345.1.64974 WP_000087345.1.65054 WP_000087345.1.65075 WP_000087345.1.6514 WP_000087345.1.65172 WP_000087345.1.65191 WP_000087345.1.65200 WP_000087345.1.65211 WP_000087345.1.65218 WP_000087345.1.65226 WP_000087345.1.65249 WP_000087345.1.65266 WP_000087345.1.65395 WP_000087345.1.65459 WP_000087345.1.65463 WP_000087345.1.65487 WP_000087345.1.6549 WP_000087345.1.65499 WP_000087345.1.6554 WP_000087345.1.65650 WP_000087345.1.65697 WP_000087345.1.65699 WP_000087345.1.65737 WP_000087345.1.65755 WP_000087345.1.65812 WP_000087345.1.65846 WP_000087345.1.65863 WP_000087345.1.65985 WP_000087345.1.66021 WP_000087345.1.66031 WP_000087345.1.66052 WP_000087345.1.66064 WP_000087345.1.66109 WP_000087345.1.66145 WP_000087345.1.66183 WP_000087345.1.6620 WP_000087345.1.66216 WP_000087345.1.66234 WP_000087345.1.66273 WP_000087345.1.66324 WP_000087345.1.6634 WP_000087345.1.66361 WP_000087345.1.66480 WP_000087345.1.66506 WP_000087345.1.66665 WP_000087345.1.66681 WP_000087345.1.66684 WP_000087345.1.66755 WP_000087345.1.66759 WP_000087345.1.66801 WP_000087345.1.66860 WP_000087345.1.66953 WP_000087345.1.66955 WP_000087345.1.66981 WP_000087345.1.67024 WP_000087345.1.67042 WP_000087345.1.67101 WP_000087345.1.67143 WP_000087345.1.67201 WP_000087345.1.67211 WP_000087345.1.67237 WP_000087345.1.67336 WP_000087345.1.67339 WP_000087345.1.67394 WP_000087345.1.67397 WP_000087345.1.67403 WP_000087345.1.67430 WP_000087345.1.67442 WP_000087345.1.67539 WP_000087345.1.67556 WP_000087345.1.67576 WP_000087345.1.67604 WP_000087345.1.67619 WP_000087345.1.67625 WP_000087345.1.67627 WP_000087345.1.67641 WP_000087345.1.67657 WP_000087345.1.67673 WP_000087345.1.67700 WP_000087345.1.67718 WP_000087345.1.67729 WP_000087345.1.67774 WP_000087345.1.67820 WP_000087345.1.67910 WP_000087345.1.67954 WP_000087345.1.68 WP_000087345.1.68043 WP_000087345.1.68105 WP_000087345.1.68113 WP_000087345.1.68131 WP_000087345.1.68182 WP_000087345.1.6819 WP_000087345.1.68285 WP_000087345.1.68359 WP_000087345.1.68420 WP_000087345.1.68514 WP_000087345.1.68564 WP_000087345.1.68688 WP_000087345.1.68742 WP_000087345.1.68770 WP_000087345.1.68809 WP_000087345.1.68914 WP_000087345.1.69053 WP_000087345.1.69170 WP_000087345.1.69210 WP_000087345.1.69270 WP_000087345.1.69282 WP_000087345.1.69376 WP_000087345.1.69396 WP_000087345.1.69466 WP_000087345.1.69611 WP_000087345.1.69642 WP_000087345.1.69656 WP_000087345.1.69690 WP_000087345.1.69923 WP_000087345.1.69948 WP_000087345.1.69953 WP_000087345.1.70010 WP_000087345.1.70049 WP_000087345.1.70058 WP_000087345.1.70061 WP_000087345.1.70205 WP_000087345.1.70240 WP_000087345.1.70249 WP_000087345.1.70261 WP_000087345.1.70314 WP_000087345.1.7033 WP_000087345.1.70427 WP_000087345.1.70433 WP_000087345.1.70545 WP_000087345.1.70623 WP_000087345.1.70671 WP_000087345.1.70679 WP_000087345.1.70708 WP_000087345.1.70717 WP_000087345.1.70731 WP_000087345.1.70772 WP_000087345.1.70845 WP_000087345.1.70846 WP_000087345.1.70981 WP_000087345.1.70995 WP_000087345.1.71039 WP_000087345.1.71057 WP_000087345.1.71081 WP_000087345.1.71117 WP_000087345.1.71186 WP_000087345.1.71455 WP_000087345.1.71456 WP_000087345.1.71487 WP_000087345.1.71523 WP_000087345.1.71542 WP_000087345.1.71566 WP_000087345.1.71640 WP_000087345.1.71651 WP_000087345.1.71653 WP_000087345.1.71716 WP_000087345.1.71872 WP_000087345.1.71950 WP_000087345.1.71954 WP_000087345.1.71985 WP_000087345.1.72003 WP_000087345.1.72073 WP_000087345.1.72269 WP_000087345.1.72350 WP_000087345.1.72383 WP_000087345.1.72461 WP_000087345.1.72527 WP_000087345.1.7255 WP_000087345.1.72631 WP_000087345.1.72638 WP_000087345.1.72667 WP_000087345.1.72674 WP_000087345.1.72789 WP_000087345.1.72828 WP_000087345.1.72896 WP_000087345.1.72969 WP_000087345.1.72987 WP_000087345.1.73052 WP_000087345.1.7311 WP_000087345.1.73114 WP_000087345.1.73180 WP_000087345.1.73258 WP_000087345.1.73285 WP_000087345.1.7332 WP_000087345.1.7333 WP_000087345.1.73352 WP_000087345.1.73389 WP_000087345.1.73425 WP_000087345.1.73488 WP_000087345.1.73504 WP_000087345.1.7353 WP_000087345.1.73544 WP_000087345.1.73598 WP_000087345.1.7361 WP_000087345.1.73648 WP_000087345.1.73768 WP_000087345.1.73849 WP_000087345.1.73948 WP_000087345.1.74024 WP_000087345.1.74030 WP_000087345.1.74038 WP_000087345.1.74043 WP_000087345.1.74058 WP_000087345.1.74070 WP_000087345.1.74077 WP_000087345.1.74135 WP_000087345.1.74214 WP_000087345.1.74241 WP_000087345.1.74285 WP_000087345.1.7430 WP_000087345.1.74317 WP_000087345.1.74415 WP_000087345.1.74616 WP_000087345.1.74621 WP_000087345.1.74647 WP_000087345.1.74677 WP_000087345.1.74699 WP_000087345.1.74894 WP_000087345.1.74929 WP_000087345.1.74939 WP_000087345.1.74973 WP_000087345.1.7507 WP_000087345.1.75089 WP_000087345.1.75116 WP_000087345.1.75237 WP_000087345.1.75273 WP_000087345.1.75296 WP_000087345.1.75413 WP_000087345.1.75433 WP_000087345.1.75532 WP_000087345.1.75565 WP_000087345.1.75593 WP_000087345.1.75610 WP_000087345.1.75633 WP_000087345.1.75718 WP_000087345.1.75745 WP_000087345.1.75844 WP_000087345.1.75886 WP_000087345.1.75898 WP_000087345.1.76081 WP_000087345.1.76116 WP_000087345.1.76122 WP_000087345.1.76256 WP_000087345.1.76339 WP_000087345.1.76366 WP_000087345.1.76417 WP_000087345.1.7646 WP_000087345.1.76510 WP_000087345.1.76558 WP_000087345.1.76572 WP_000087345.1.76641 WP_000087345.1.76651 WP_000087345.1.76653 WP_000087345.1.76788 WP_000087345.1.76854 WP_000087345.1.76916 WP_000087345.1.76932 WP_000087345.1.76973 WP_000087345.1.76988 WP_000087345.1.77016 WP_000087345.1.77087 WP_000087345.1.77090 WP_000087345.1.77111 WP_000087345.1.77299 WP_000087345.1.77384 WP_000087345.1.77501 WP_000087345.1.77512 WP_000087345.1.77513 WP_000087345.1.77563 WP_000087345.1.77702 WP_000087345.1.77713 WP_000087345.1.7772 WP_000087345.1.77825 WP_000087345.1.77837 WP_000087345.1.77900 WP_000087345.1.77923 WP_000087345.1.77975 WP_000087345.1.78035 WP_000087345.1.78048 WP_000087345.1.78107 WP_000087345.1.78166 WP_000087345.1.78192 WP_000087345.1.78195 WP_000087345.1.78291 WP_000087345.1.78309 WP_000087345.1.78320 WP_000087345.1.78382 WP_000087345.1.78388 WP_000087345.1.78410 WP_000087345.1.7862 WP_000087345.1.78626 WP_000087345.1.78661 WP_000087345.1.78674 WP_000087345.1.78676 WP_000087345.1.789 WP_000087345.1.78993 WP_000087345.1.79012 WP_000087345.1.79069 WP_000087345.1.79074 WP_000087345.1.79098 WP_000087345.1.79155 WP_000087345.1.79164 WP_000087345.1.79204 WP_000087345.1.79280 WP_000087345.1.79397 WP_000087345.1.79456 WP_000087345.1.79532 WP_000087345.1.79547 WP_000087345.1.79654 WP_000087345.1.7970 WP_000087345.1.79722 WP_000087345.1.79772 WP_000087345.1.79880 WP_000087345.1.79916 WP_000087345.1.80065 WP_000087345.1.80103 WP_000087345.1.80273 WP_000087345.1.80282 WP_000087345.1.80354 WP_000087345.1.80368 WP_000087345.1.80386 WP_000087345.1.80400 WP_000087345.1.8049 WP_000087345.1.80492 WP_000087345.1.80569 WP_000087345.1.80664 WP_000087345.1.80696 WP_000087345.1.81131 WP_000087345.1.81187 WP_000087345.1.81262 WP_000087345.1.81268 WP_000087345.1.81269 WP_000087345.1.81271 WP_000087345.1.8131 WP_000087345.1.81333 WP_000087345.1.81342 WP_000087345.1.81364 WP_000087345.1.81557 WP_000087345.1.81676 WP_000087345.1.81681 WP_000087345.1.8170 WP_000087345.1.81763 WP_000087345.1.81855 WP_000087345.1.81921 WP_000087345.1.81931 WP_000087345.1.81936 WP_000087345.1.81949 WP_000087345.1.82070 WP_000087345.1.82076 WP_000087345.1.82131 WP_000087345.1.82156 WP_000087345.1.8218 WP_000087345.1.82180 WP_000087345.1.82201 WP_000087345.1.82214 WP_000087345.1.82225 WP_000087345.1.8240 WP_000087345.1.82408 WP_000087345.1.82416 WP_000087345.1.8242 WP_000087345.1.82465 WP_000087345.1.82473 WP_000087345.1.82553 WP_000087345.1.82646 WP_000087345.1.82670 WP_000087345.1.82731 WP_000087345.1.82812 WP_000087345.1.82850 WP_000087345.1.82872 WP_000087345.1.8294 WP_000087345.1.82959 WP_000087345.1.83007 WP_000087345.1.8304 WP_000087345.1.83180 WP_000087345.1.83229 WP_000087345.1.83235 WP_000087345.1.83290 WP_000087345.1.83333 WP_000087345.1.83657 WP_000087345.1.83677 WP_000087345.1.8375 WP_000087345.1.83923 WP_000087345.1.83994 WP_000087345.1.84 WP_000087345.1.8406 WP_000087345.1.84076 WP_000087345.1.84110 WP_000087345.1.84127 WP_000087345.1.84150 WP_000087345.1.84230 WP_000087345.1.84252 WP_000087345.1.8431 WP_000087345.1.84345 WP_000087345.1.84369 WP_000087345.1.84401 WP_000087345.1.84435 WP_000087345.1.84567 WP_000087345.1.84631 WP_000087345.1.84727 WP_000087345.1.84744 WP_000087345.1.84773 WP_000087345.1.84945 WP_000087345.1.84967 WP_000087345.1.8502 WP_000087345.1.85039 WP_000087345.1.85153 WP_000087345.1.85273 WP_000087345.1.85338 WP_000087345.1.85339 WP_000087345.1.85511 WP_000087345.1.85512 WP_000087345.1.8557 WP_000087345.1.85606 WP_000087345.1.85635 WP_000087345.1.85646 WP_000087345.1.85665 WP_000087345.1.85669 WP_000087345.1.85688 WP_000087345.1.85703 WP_000087345.1.85728 WP_000087345.1.85746 WP_000087345.1.85811 WP_000087345.1.859 WP_000087345.1.85917 WP_000087345.1.8594 WP_000087345.1.85977 WP_000087345.1.860 WP_000087345.1.8605 WP_000087345.1.86084 WP_000087345.1.8610 WP_000087345.1.8614 WP_000087345.1.86342 WP_000087345.1.8640 WP_000087345.1.8642 WP_000087345.1.86426 WP_000087345.1.86489 WP_000087345.1.86530 WP_000087345.1.86663 WP_000087345.1.86770 WP_000087345.1.86794 WP_000087345.1.86800 WP_000087345.1.86811 WP_000087345.1.86815 WP_000087345.1.86945 WP_000087345.1.86989 WP_000087345.1.87023 WP_000087345.1.87041 WP_000087345.1.87136 WP_000087345.1.87155 WP_000087345.1.87258 WP_000087345.1.87293 WP_000087345.1.87420 WP_000087345.1.87528 WP_000087345.1.87560 WP_000087345.1.8760 WP_000087345.1.87600 WP_000087345.1.87609 WP_000087345.1.87612 WP_000087345.1.87615 WP_000087345.1.87653 WP_000087345.1.87659 WP_000087345.1.87698 WP_000087345.1.87706 WP_000087345.1.87739 WP_000087345.1.87741 WP_000087345.1.87742 WP_000087345.1.87852 WP_000087345.1.87949 WP_000087345.1.88025 WP_000087345.1.88026 WP_000087345.1.8805 WP_000087345.1.8806 WP_000087345.1.881 WP_000087345.1.88145 WP_000087345.1.88199 WP_000087345.1.88299 WP_000087345.1.88313 WP_000087345.1.88359 WP_000087345.1.88407 WP_000087345.1.88414 WP_000087345.1.88444 WP_000087345.1.88446 WP_000087345.1.88458 WP_000087345.1.88501 WP_000087345.1.88538 WP_000087345.1.88547 WP_000087345.1.886 WP_000087345.1.88647 WP_000087345.1.88648 WP_000087345.1.88692 WP_000087345.1.88707 WP_000087345.1.88727 WP_000087345.1.88772 WP_000087345.1.88850 WP_000087345.1.8889 WP_000087345.1.88892 WP_000087345.1.88894 WP_000087345.1.89182 WP_000087345.1.89298 WP_000087345.1.89308 WP_000087345.1.89314 WP_000087345.1.89328 WP_000087345.1.89332 WP_000087345.1.89343 WP_000087345.1.89395 WP_000087345.1.8940 WP_000087345.1.89449 WP_000087345.1.8947 WP_000087345.1.89503 WP_000087345.1.89591 WP_000087345.1.89612 WP_000087345.1.89668 WP_000087345.1.89706 WP_000087345.1.89713 WP_000087345.1.89733 WP_000087345.1.89796 WP_000087345.1.89804 WP_000087345.1.89845 WP_000087345.1.89888 WP_000087345.1.89911 WP_000087345.1.8995 WP_000087345.1.89952 WP_000087345.1.90007 WP_000087345.1.9011 WP_000087345.1.90196 WP_000087345.1.90240 WP_000087345.1.90274 WP_000087345.1.90280 WP_000087345.1.90330 WP_000087345.1.90338 WP_000087345.1.90365 WP_000087345.1.90428 WP_000087345.1.90489 WP_000087345.1.90513 WP_000087345.1.90582 WP_000087345.1.90713 WP_000087345.1.90794 WP_000087345.1.90796 WP_000087345.1.90811 WP_000087345.1.9091 WP_000087345.1.91067 WP_000087345.1.91164 WP_000087345.1.91205 WP_000087345.1.91239 WP_000087345.1.91291 WP_000087345.1.91313 WP_000087345.1.9135 WP_000087345.1.91506 WP_000087345.1.91557 WP_000087345.1.91597 WP_000087345.1.91715 WP_000087345.1.9187 WP_000087345.1.91870 WP_000087345.1.92018 WP_000087345.1.92087 WP_000087345.1.92098 WP_000087345.1.92156 WP_000087345.1.92172 WP_000087345.1.92240 WP_000087345.1.92243 WP_000087345.1.92327 WP_000087345.1.92470 WP_000087345.1.92477 WP_000087345.1.92545 WP_000087345.1.92570 WP_000087345.1.92588 WP_000087345.1.926 WP_000087345.1.92633 WP_000087345.1.92649 WP_000087345.1.92676 WP_000087345.1.9271 WP_000087345.1.92734 WP_000087345.1.92810 WP_000087345.1.92823 WP_000087345.1.92987 WP_000087345.1.93007 WP_000087345.1.93022 WP_000087345.1.93103 WP_000087345.1.93105 WP_000087345.1.93111 WP_000087345.1.93121 WP_000087345.1.93168 WP_000087345.1.93184 WP_000087345.1.93221 WP_000087345.1.93223 WP_000087345.1.93239 WP_000087345.1.93302 WP_000087345.1.9336 WP_000087345.1.93387 WP_000087345.1.93469 WP_000087345.1.93511 WP_000087345.1.93512 WP_000087345.1.93635 WP_000087345.1.93657 WP_000087345.1.9374 WP_000087345.1.9375 WP_000087345.1.93754 WP_000087345.1.93780 WP_000087345.1.93828 WP_000087345.1.93842 WP_000087345.1.93843 WP_000087345.1.93875 WP_000087345.1.93909 WP_000087345.1.93919 WP_000087345.1.93938 WP_000087345.1.9399 WP_000087345.1.94017 WP_000087345.1.94079 WP_000087345.1.94097 WP_000087345.1.94107 WP_000087345.1.94142 WP_000087345.1.94215 WP_000087345.1.94303 WP_000087345.1.94365 WP_000087345.1.94390 WP_000087345.1.94415 WP_000087345.1.94492 WP_000087345.1.94510 WP_000087345.1.94527 WP_000087345.1.94573 WP_000087345.1.94579 WP_000087345.1.94586 WP_000087345.1.94593 WP_000087345.1.94650 WP_000087345.1.94659 WP_000087345.1.94662 WP_000087345.1.94700 WP_000087345.1.94745 WP_000087345.1.94782 WP_000087345.1.94815 WP_000087345.1.94820 WP_000087345.1.94850 WP_000087345.1.94851 WP_000087345.1.94864 WP_000087345.1.94952 WP_000087345.1.95006 WP_000087345.1.95055 WP_000087345.1.95076 WP_000087345.1.95099 WP_000087345.1.95165 WP_000087345.1.95239 WP_000087345.1.95246 WP_000087345.1.9525 WP_000087345.1.95255 WP_000087345.1.95265 WP_000087345.1.95338 WP_000087345.1.95412 WP_000087345.1.95530 WP_000087345.1.95547 WP_000087345.1.95590 WP_000087345.1.95675 WP_000087345.1.95716 WP_000087345.1.95776 WP_000087345.1.95884 WP_000087345.1.95890 WP_000087345.1.95906 WP_000087345.1.96025 WP_000087345.1.96044 WP_000087345.1.96054 WP_000087345.1.96094 WP_000087345.1.96127 WP_000087345.1.96144 WP_000087345.1.96188 WP_000087345.1.96211 WP_000087345.1.96212 WP_000087345.1.96319 WP_000087345.1.9633 WP_000087345.1.96359 WP_000087345.1.96539 WP_000087345.1.96552 WP_000087345.1.96610 WP_000087345.1.96625 WP_000087345.1.96635 WP_000087345.1.9664 WP_000087345.1.9670 WP_000087345.1.96750 WP_000087345.1.96792 WP_000087345.1.96801 WP_000087345.1.96803 WP_000087345.1.96925 WP_000087345.1.96938 WP_000087345.1.96946 WP_000087345.1.96957 WP_000087345.1.96978 WP_000087345.1.97026 WP_000087345.1.97028 WP_000087345.1.97079 WP_000087345.1.97154 WP_000087345.1.97184 WP_000087345.1.97287 WP_000087345.1.97291 WP_000087345.1.97422 WP_000087345.1.97441 WP_000087345.1.97505 WP_000087345.1.97599 WP_000087345.1.97606 WP_000087345.1.97615 WP_000087345.1.97646 WP_000087345.1.97690 WP_000087345.1.97819 WP_000087345.1.97840 WP_000087345.1.97938 WP_000087345.1.97986 WP_000087345.1.98036 WP_000087345.1.98080 WP_000087345.1.98086 WP_000087345.1.98158 WP_000087345.1.98263 WP_000087345.1.98418 WP_000087345.1.98448 WP_000087345.1.98457 WP_000087345.1.9850 WP_000087345.1.98502 WP_000087345.1.98607 WP_000087345.1.98731 WP_000087345.1.98762 WP_000087345.1.9877 WP_000087345.1.98801 WP_000087345.1.98818 WP_000087345.1.99163 WP_000087345.1.99335 WP_000087345.1.99350 WP_000087345.1.99363 WP_000087345.1.99369 WP_000087345.1.99388 WP_000087345.1.99397 WP_000087345.1.99463 WP_000087345.1.99483 WP_000087345.1.99546 WP_000087345.1.99579 WP_000087345.1.99671 WP_000087345.1.99676 WP_000087345.1.99764 WP_000087345.1.99829 WP_000087345.1.99837 WP_000087345.1.99841 WP_000087345.1.9992 WP_000087345.1.99996 gi|488652938|ref|YP_007924741.1| gi|29140912|ref|NP_804254.1| gi|378958529|ref|YP_005216015.1| gi|16761391|ref|NP_457008.1| 209261.t0385 220341.STY2711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]