SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488653002|ref|YP_007924805.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488653002|ref|YP_007924805.1|
Domain Number 1 Region: 355-538
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5e-44
Family Pyruvate oxidase and decarboxylase PP module 0.000000248
Further Details:      
 
Domain Number 2 Region: 5-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.75e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.000000126
Further Details:      
 
Domain Number 3 Region: 167-321
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.34e-26
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488653002|ref|YP_007924805.1|
Sequence length 550
Comment putative decarboxylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MQNPYTVADYLLDRLAGCGIGHLFGVPGDYNLQFLDHVIDHPTLRWVGCANELNAAYTAD
GYARMSGAGALLTTFGVGELSAINGIAGSYAEYVPVLHIVGAPCSAAQQRGELMHHTLGD
GDFRHFYRMSQAISAASAILDEQNACFEIDRVLGEMLAARRPGYIMLPADVAKKTAIPPT
EALALPVHEAQSGVETAFRYHARQCLMNSRRIALLADFLAGRFGLRPLLQRWMAETPIAH
ATLLMGKGLFDEQHPNFVGTYSAGASSKEVRQAIEDADRVICVGTRFVDTLTAGFTQQLP
AERTLEIQPYASRIGETWFNLPMAQAVSTLRELCLECAFAPPPTRSAGQPVRIDKGELTQ
ESFWQTLQQCLKPGDIILVDQGTAAFGAAALSLPDGAEVVVQPLWGSIGYSLPAAFGAQT
ACPDRRVILIIGDGAAQLTIQEMGSMLRDGQAPVILLLNNDGYTVERAIHGAAQRYNDIA
SWNWTQIPPALNAAQQAECWRVTQAIQLAEVLERLARPQRLSFIEVMLPKADLPELLRTV
TRALEARNGG
Download sequence
Identical sequences Q8Z4X7
gi|29140973|ref|NP_804315.1| AE014613|CDS_522062-523714 AL513382|CDS_2482650-2480998 gi|16761331|ref|NP_456948.1| gi|488653002|ref|YP_007924805.1| gi|378958594|ref|YP_005216080.1| NP_456948.1.84458 WP_001180878.1.100008 WP_001180878.1.100036 WP_001180878.1.100079 WP_001180878.1.100196 WP_001180878.1.100284 WP_001180878.1.100313 WP_001180878.1.100314 WP_001180878.1.100321 WP_001180878.1.100354 WP_001180878.1.100421 WP_001180878.1.100446 WP_001180878.1.100450 WP_001180878.1.100592 WP_001180878.1.100610 WP_001180878.1.100732 WP_001180878.1.100733 WP_001180878.1.100739 WP_001180878.1.100764 WP_001180878.1.100799 WP_001180878.1.100941 WP_001180878.1.100953 WP_001180878.1.101011 WP_001180878.1.10108 WP_001180878.1.101226 WP_001180878.1.10124 WP_001180878.1.101271 WP_001180878.1.101312 WP_001180878.1.101322 WP_001180878.1.101374 WP_001180878.1.101616 WP_001180878.1.101890 WP_001180878.1.101941 WP_001180878.1.102050 WP_001180878.1.102087 WP_001180878.1.10338 WP_001180878.1.1038 WP_001180878.1.104 WP_001180878.1.10401 WP_001180878.1.10428 WP_001180878.1.10459 WP_001180878.1.10475 WP_001180878.1.10511 WP_001180878.1.10514 WP_001180878.1.10530 WP_001180878.1.10532 WP_001180878.1.10547 WP_001180878.1.10595 WP_001180878.1.10642 WP_001180878.1.10654 WP_001180878.1.10677 WP_001180878.1.10857 WP_001180878.1.10873 WP_001180878.1.10926 WP_001180878.1.10936 WP_001180878.1.11012 WP_001180878.1.11055 WP_001180878.1.11126 WP_001180878.1.11142 WP_001180878.1.11239 WP_001180878.1.11253 WP_001180878.1.11314 WP_001180878.1.11385 WP_001180878.1.1142 WP_001180878.1.11426 WP_001180878.1.11429 WP_001180878.1.11557 WP_001180878.1.11567 WP_001180878.1.11638 WP_001180878.1.11883 WP_001180878.1.11908 WP_001180878.1.11914 WP_001180878.1.12040 WP_001180878.1.12061 WP_001180878.1.1207 WP_001180878.1.12141 WP_001180878.1.12172 WP_001180878.1.12192 WP_001180878.1.1224 WP_001180878.1.12364 WP_001180878.1.12398 WP_001180878.1.12441 WP_001180878.1.12581 WP_001180878.1.12620 WP_001180878.1.12648 WP_001180878.1.12683 WP_001180878.1.12726 WP_001180878.1.12727 WP_001180878.1.12741 WP_001180878.1.12834 WP_001180878.1.13108 WP_001180878.1.13161 WP_001180878.1.1321 WP_001180878.1.13268 WP_001180878.1.13291 WP_001180878.1.133 WP_001180878.1.13314 WP_001180878.1.13338 WP_001180878.1.13342 WP_001180878.1.13352 WP_001180878.1.13406 WP_001180878.1.13440 WP_001180878.1.13443 WP_001180878.1.13476 WP_001180878.1.13599 WP_001180878.1.13686 WP_001180878.1.1372 WP_001180878.1.13732 WP_001180878.1.1382 WP_001180878.1.1397 WP_001180878.1.13972 WP_001180878.1.140 WP_001180878.1.1401 WP_001180878.1.1408 WP_001180878.1.14089 WP_001180878.1.14099 WP_001180878.1.14120 WP_001180878.1.14123 WP_001180878.1.14150 WP_001180878.1.14191 WP_001180878.1.14197 WP_001180878.1.14280 WP_001180878.1.14333 WP_001180878.1.14399 WP_001180878.1.14444 WP_001180878.1.14467 WP_001180878.1.14474 WP_001180878.1.14500 WP_001180878.1.14526 WP_001180878.1.14550 WP_001180878.1.14575 WP_001180878.1.14701 WP_001180878.1.14703 WP_001180878.1.14719 WP_001180878.1.1473 WP_001180878.1.14765 WP_001180878.1.14810 WP_001180878.1.14877 WP_001180878.1.14894 WP_001180878.1.14930 WP_001180878.1.14947 WP_001180878.1.14948 WP_001180878.1.15184 WP_001180878.1.15244 WP_001180878.1.15265 WP_001180878.1.15362 WP_001180878.1.15415 WP_001180878.1.15423 WP_001180878.1.15433 WP_001180878.1.15439 WP_001180878.1.15487 WP_001180878.1.15535 WP_001180878.1.15581 WP_001180878.1.15597 WP_001180878.1.15710 WP_001180878.1.15717 WP_001180878.1.15905 WP_001180878.1.15912 WP_001180878.1.15970 WP_001180878.1.16046 WP_001180878.1.16051 WP_001180878.1.16058 WP_001180878.1.16150 WP_001180878.1.16155 WP_001180878.1.1626 WP_001180878.1.16344 WP_001180878.1.16461 WP_001180878.1.16462 WP_001180878.1.16465 WP_001180878.1.16522 WP_001180878.1.16588 WP_001180878.1.16658 WP_001180878.1.16666 WP_001180878.1.16673 WP_001180878.1.1674 WP_001180878.1.16767 WP_001180878.1.16781 WP_001180878.1.16879 WP_001180878.1.16893 WP_001180878.1.16905 WP_001180878.1.17049 WP_001180878.1.17058 WP_001180878.1.17078 WP_001180878.1.17202 WP_001180878.1.17219 WP_001180878.1.1722 WP_001180878.1.17302 WP_001180878.1.17308 WP_001180878.1.17368 WP_001180878.1.17405 WP_001180878.1.17406 WP_001180878.1.17513 WP_001180878.1.17543 WP_001180878.1.17563 WP_001180878.1.17578 WP_001180878.1.17622 WP_001180878.1.17659 WP_001180878.1.17667 WP_001180878.1.17741 WP_001180878.1.17840 WP_001180878.1.17956 WP_001180878.1.18005 WP_001180878.1.1801 WP_001180878.1.18021 WP_001180878.1.18099 WP_001180878.1.18124 WP_001180878.1.18144 WP_001180878.1.18173 WP_001180878.1.18270 WP_001180878.1.18280 WP_001180878.1.18328 WP_001180878.1.18358 WP_001180878.1.18370 WP_001180878.1.18406 WP_001180878.1.18474 WP_001180878.1.18513 WP_001180878.1.18610 WP_001180878.1.18678 WP_001180878.1.18722 WP_001180878.1.18766 WP_001180878.1.1880 WP_001180878.1.1885 WP_001180878.1.18860 WP_001180878.1.18922 WP_001180878.1.18959 WP_001180878.1.19001 WP_001180878.1.19006 WP_001180878.1.19044 WP_001180878.1.19084 WP_001180878.1.19187 WP_001180878.1.19228 WP_001180878.1.19288 WP_001180878.1.19300 WP_001180878.1.19422 WP_001180878.1.19454 WP_001180878.1.19456 WP_001180878.1.19496 WP_001180878.1.19535 WP_001180878.1.19538 WP_001180878.1.19589 WP_001180878.1.19663 WP_001180878.1.19686 WP_001180878.1.19731 WP_001180878.1.19794 WP_001180878.1.1992 WP_001180878.1.19999 WP_001180878.1.20254 WP_001180878.1.20255 WP_001180878.1.20296 WP_001180878.1.20339 WP_001180878.1.20419 WP_001180878.1.20465 WP_001180878.1.20492 WP_001180878.1.2053 WP_001180878.1.20635 WP_001180878.1.20718 WP_001180878.1.2073 WP_001180878.1.20740 WP_001180878.1.20828 WP_001180878.1.2087 WP_001180878.1.20883 WP_001180878.1.20947 WP_001180878.1.20953 WP_001180878.1.21010 WP_001180878.1.2106 WP_001180878.1.21062 WP_001180878.1.21144 WP_001180878.1.21162 WP_001180878.1.21184 WP_001180878.1.21185 WP_001180878.1.21366 WP_001180878.1.21492 WP_001180878.1.2166 WP_001180878.1.21674 WP_001180878.1.21946 WP_001180878.1.21966 WP_001180878.1.22064 WP_001180878.1.22118 WP_001180878.1.22126 WP_001180878.1.2216 WP_001180878.1.22208 WP_001180878.1.2227 WP_001180878.1.22373 WP_001180878.1.22476 WP_001180878.1.22614 WP_001180878.1.22652 WP_001180878.1.22683 WP_001180878.1.2284 WP_001180878.1.22895 WP_001180878.1.22926 WP_001180878.1.22943 WP_001180878.1.22967 WP_001180878.1.23040 WP_001180878.1.23058 WP_001180878.1.23218 WP_001180878.1.2331 WP_001180878.1.2332 WP_001180878.1.23340 WP_001180878.1.2336 WP_001180878.1.23365 WP_001180878.1.23412 WP_001180878.1.23426 WP_001180878.1.23515 WP_001180878.1.23548 WP_001180878.1.23571 WP_001180878.1.23604 WP_001180878.1.23679 WP_001180878.1.23728 WP_001180878.1.2375 WP_001180878.1.23783 WP_001180878.1.23786 WP_001180878.1.23787 WP_001180878.1.23801 WP_001180878.1.24028 WP_001180878.1.24061 WP_001180878.1.24083 WP_001180878.1.24117 WP_001180878.1.24125 WP_001180878.1.24138 WP_001180878.1.24153 WP_001180878.1.24291 WP_001180878.1.24322 WP_001180878.1.24355 WP_001180878.1.24375 WP_001180878.1.24400 WP_001180878.1.24420 WP_001180878.1.24619 WP_001180878.1.24643 WP_001180878.1.24688 WP_001180878.1.24716 WP_001180878.1.2481 WP_001180878.1.24832 WP_001180878.1.24964 WP_001180878.1.25017 WP_001180878.1.25032 WP_001180878.1.25041 WP_001180878.1.25053 WP_001180878.1.25140 WP_001180878.1.25185 WP_001180878.1.25196 WP_001180878.1.25210 WP_001180878.1.25219 WP_001180878.1.25374 WP_001180878.1.25475 WP_001180878.1.25490 WP_001180878.1.25508 WP_001180878.1.25512 WP_001180878.1.25603 WP_001180878.1.2562 WP_001180878.1.25666 WP_001180878.1.25807 WP_001180878.1.25821 WP_001180878.1.25833 WP_001180878.1.25835 WP_001180878.1.25882 WP_001180878.1.25911 WP_001180878.1.25962 WP_001180878.1.25963 WP_001180878.1.26001 WP_001180878.1.26027 WP_001180878.1.26107 WP_001180878.1.2615 WP_001180878.1.26217 WP_001180878.1.26230 WP_001180878.1.26232 WP_001180878.1.26272 WP_001180878.1.26286 WP_001180878.1.26288 WP_001180878.1.26394 WP_001180878.1.26491 WP_001180878.1.2654 WP_001180878.1.26554 WP_001180878.1.26636 WP_001180878.1.26689 WP_001180878.1.2679 WP_001180878.1.26908 WP_001180878.1.2692 WP_001180878.1.26928 WP_001180878.1.270 WP_001180878.1.27008 WP_001180878.1.27027 WP_001180878.1.27070 WP_001180878.1.27077 WP_001180878.1.27086 WP_001180878.1.27087 WP_001180878.1.27111 WP_001180878.1.27115 WP_001180878.1.2713 WP_001180878.1.2717 WP_001180878.1.27228 WP_001180878.1.27282 WP_001180878.1.27285 WP_001180878.1.27309 WP_001180878.1.27329 WP_001180878.1.27361 WP_001180878.1.27565 WP_001180878.1.27595 WP_001180878.1.27598 WP_001180878.1.27706 WP_001180878.1.27775 WP_001180878.1.27785 WP_001180878.1.27900 WP_001180878.1.27928 WP_001180878.1.27945 WP_001180878.1.28004 WP_001180878.1.2809 WP_001180878.1.28155 WP_001180878.1.28198 WP_001180878.1.2822 WP_001180878.1.28229 WP_001180878.1.28384 WP_001180878.1.28386 WP_001180878.1.28395 WP_001180878.1.284 WP_001180878.1.2845 WP_001180878.1.28479 WP_001180878.1.28627 WP_001180878.1.28692 WP_001180878.1.2873 WP_001180878.1.28917 WP_001180878.1.28962 WP_001180878.1.29023 WP_001180878.1.29042 WP_001180878.1.2905 WP_001180878.1.2907 WP_001180878.1.29081 WP_001180878.1.29089 WP_001180878.1.29153 WP_001180878.1.29203 WP_001180878.1.29237 WP_001180878.1.29248 WP_001180878.1.29288 WP_001180878.1.29389 WP_001180878.1.29439 WP_001180878.1.2946 WP_001180878.1.29462 WP_001180878.1.29563 WP_001180878.1.29727 WP_001180878.1.29743 WP_001180878.1.29782 WP_001180878.1.29833 WP_001180878.1.29851 WP_001180878.1.29865 WP_001180878.1.29886 WP_001180878.1.29919 WP_001180878.1.2994 WP_001180878.1.29964 WP_001180878.1.29983 WP_001180878.1.30009 WP_001180878.1.30013 WP_001180878.1.3002 WP_001180878.1.30034 WP_001180878.1.30049 WP_001180878.1.30058 WP_001180878.1.30172 WP_001180878.1.30185 WP_001180878.1.30354 WP_001180878.1.30357 WP_001180878.1.30362 WP_001180878.1.3042 WP_001180878.1.30421 WP_001180878.1.30440 WP_001180878.1.30448 WP_001180878.1.30489 WP_001180878.1.30517 WP_001180878.1.30542 WP_001180878.1.30556 WP_001180878.1.30572 WP_001180878.1.30618 WP_001180878.1.30664 WP_001180878.1.30688 WP_001180878.1.30806 WP_001180878.1.30967 WP_001180878.1.31046 WP_001180878.1.31066 WP_001180878.1.31078 WP_001180878.1.31139 WP_001180878.1.31145 WP_001180878.1.31182 WP_001180878.1.31205 WP_001180878.1.3121 WP_001180878.1.31223 WP_001180878.1.31303 WP_001180878.1.3131 WP_001180878.1.31352 WP_001180878.1.31389 WP_001180878.1.31413 WP_001180878.1.31446 WP_001180878.1.31533 WP_001180878.1.31799 WP_001180878.1.31836 WP_001180878.1.31951 WP_001180878.1.32041 WP_001180878.1.32042 WP_001180878.1.3207 WP_001180878.1.32189 WP_001180878.1.32202 WP_001180878.1.32263 WP_001180878.1.32293 WP_001180878.1.32299 WP_001180878.1.32422 WP_001180878.1.32425 WP_001180878.1.32458 WP_001180878.1.32460 WP_001180878.1.32529 WP_001180878.1.32563 WP_001180878.1.32578 WP_001180878.1.32617 WP_001180878.1.3270 WP_001180878.1.32725 WP_001180878.1.32838 WP_001180878.1.32848 WP_001180878.1.32868 WP_001180878.1.3290 WP_001180878.1.32940 WP_001180878.1.32941 WP_001180878.1.3296 WP_001180878.1.32966 WP_001180878.1.32985 WP_001180878.1.33037 WP_001180878.1.3305 WP_001180878.1.33051 WP_001180878.1.33065 WP_001180878.1.33122 WP_001180878.1.3315 WP_001180878.1.33208 WP_001180878.1.33214 WP_001180878.1.33247 WP_001180878.1.33280 WP_001180878.1.33283 WP_001180878.1.33313 WP_001180878.1.33339 WP_001180878.1.33382 WP_001180878.1.33490 WP_001180878.1.33501 WP_001180878.1.33529 WP_001180878.1.33689 WP_001180878.1.3370 WP_001180878.1.33730 WP_001180878.1.33741 WP_001180878.1.33840 WP_001180878.1.3392 WP_001180878.1.33926 WP_001180878.1.33957 WP_001180878.1.33969 WP_001180878.1.34001 WP_001180878.1.34059 WP_001180878.1.34118 WP_001180878.1.34211 WP_001180878.1.34214 WP_001180878.1.34234 WP_001180878.1.34284 WP_001180878.1.34376 WP_001180878.1.34382 WP_001180878.1.34484 WP_001180878.1.34517 WP_001180878.1.34530 WP_001180878.1.34665 WP_001180878.1.34694 WP_001180878.1.34751 WP_001180878.1.34808 WP_001180878.1.34824 WP_001180878.1.34834 WP_001180878.1.34932 WP_001180878.1.34962 WP_001180878.1.35001 WP_001180878.1.35040 WP_001180878.1.35074 WP_001180878.1.35175 WP_001180878.1.35240 WP_001180878.1.35274 WP_001180878.1.35532 WP_001180878.1.35560 WP_001180878.1.3557 WP_001180878.1.35628 WP_001180878.1.3570 WP_001180878.1.35712 WP_001180878.1.35713 WP_001180878.1.35736 WP_001180878.1.35791 WP_001180878.1.35795 WP_001180878.1.35870 WP_001180878.1.35916 WP_001180878.1.35938 WP_001180878.1.35966 WP_001180878.1.36000 WP_001180878.1.36034 WP_001180878.1.36036 WP_001180878.1.36069 WP_001180878.1.36291 WP_001180878.1.36298 WP_001180878.1.36308 WP_001180878.1.36323 WP_001180878.1.36343 WP_001180878.1.36460 WP_001180878.1.3649 WP_001180878.1.36495 WP_001180878.1.36526 WP_001180878.1.36567 WP_001180878.1.36579 WP_001180878.1.36617 WP_001180878.1.36618 WP_001180878.1.36643 WP_001180878.1.36663 WP_001180878.1.36701 WP_001180878.1.36725 WP_001180878.1.36779 WP_001180878.1.36798 WP_001180878.1.36802 WP_001180878.1.36821 WP_001180878.1.36853 WP_001180878.1.36950 WP_001180878.1.37014 WP_001180878.1.37133 WP_001180878.1.37176 WP_001180878.1.37199 WP_001180878.1.37200 WP_001180878.1.37258 WP_001180878.1.37303 WP_001180878.1.37513 WP_001180878.1.37584 WP_001180878.1.37590 WP_001180878.1.37593 WP_001180878.1.37600 WP_001180878.1.37613 WP_001180878.1.37659 WP_001180878.1.37662 WP_001180878.1.37675 WP_001180878.1.37691 WP_001180878.1.37761 WP_001180878.1.37775 WP_001180878.1.37777 WP_001180878.1.378 WP_001180878.1.379 WP_001180878.1.37911 WP_001180878.1.37941 WP_001180878.1.37985 WP_001180878.1.38061 WP_001180878.1.38064 WP_001180878.1.38108 WP_001180878.1.3816 WP_001180878.1.38207 WP_001180878.1.38261 WP_001180878.1.38266 WP_001180878.1.38310 WP_001180878.1.3834 WP_001180878.1.38351 WP_001180878.1.3838 WP_001180878.1.38381 WP_001180878.1.38440 WP_001180878.1.38486 WP_001180878.1.38515 WP_001180878.1.38595 WP_001180878.1.3860 WP_001180878.1.38642 WP_001180878.1.38734 WP_001180878.1.38877 WP_001180878.1.38983 WP_001180878.1.38996 WP_001180878.1.39056 WP_001180878.1.3907 WP_001180878.1.39105 WP_001180878.1.3914 WP_001180878.1.39147 WP_001180878.1.39161 WP_001180878.1.39210 WP_001180878.1.39235 WP_001180878.1.3931 WP_001180878.1.39435 WP_001180878.1.39502 WP_001180878.1.39530 WP_001180878.1.39619 WP_001180878.1.39620 WP_001180878.1.39624 WP_001180878.1.39659 WP_001180878.1.39667 WP_001180878.1.39775 WP_001180878.1.39879 WP_001180878.1.39890 WP_001180878.1.39941 WP_001180878.1.39945 WP_001180878.1.39947 WP_001180878.1.40095 WP_001180878.1.40097 WP_001180878.1.401 WP_001180878.1.40160 WP_001180878.1.40167 WP_001180878.1.40279 WP_001180878.1.40361 WP_001180878.1.4042 WP_001180878.1.40467 WP_001180878.1.40496 WP_001180878.1.40517 WP_001180878.1.40698 WP_001180878.1.40750 WP_001180878.1.40763 WP_001180878.1.40854 WP_001180878.1.4089 WP_001180878.1.40924 WP_001180878.1.40932 WP_001180878.1.40946 WP_001180878.1.41004 WP_001180878.1.4106 WP_001180878.1.41070 WP_001180878.1.41074 WP_001180878.1.41075 WP_001180878.1.41097 WP_001180878.1.41132 WP_001180878.1.41176 WP_001180878.1.41251 WP_001180878.1.41258 WP_001180878.1.41305 WP_001180878.1.41321 WP_001180878.1.41333 WP_001180878.1.41335 WP_001180878.1.4136 WP_001180878.1.41415 WP_001180878.1.41459 WP_001180878.1.41498 WP_001180878.1.41519 WP_001180878.1.41524 WP_001180878.1.41631 WP_001180878.1.41658 WP_001180878.1.41659 WP_001180878.1.41716 WP_001180878.1.41746 WP_001180878.1.41824 WP_001180878.1.41825 WP_001180878.1.41836 WP_001180878.1.41894 WP_001180878.1.41919 WP_001180878.1.41929 WP_001180878.1.4194 WP_001180878.1.42069 WP_001180878.1.42081 WP_001180878.1.42090 WP_001180878.1.42111 WP_001180878.1.42187 WP_001180878.1.42200 WP_001180878.1.42219 WP_001180878.1.42257 WP_001180878.1.42261 WP_001180878.1.42349 WP_001180878.1.42364 WP_001180878.1.42371 WP_001180878.1.42379 WP_001180878.1.42391 WP_001180878.1.42399 WP_001180878.1.42539 WP_001180878.1.42603 WP_001180878.1.42650 WP_001180878.1.4267 WP_001180878.1.42701 WP_001180878.1.42805 WP_001180878.1.42815 WP_001180878.1.42859 WP_001180878.1.4298 WP_001180878.1.43008 WP_001180878.1.43016 WP_001180878.1.43019 WP_001180878.1.43065 WP_001180878.1.43068 WP_001180878.1.43069 WP_001180878.1.43128 WP_001180878.1.43141 WP_001180878.1.43157 WP_001180878.1.43161 WP_001180878.1.43190 WP_001180878.1.43198 WP_001180878.1.4326 WP_001180878.1.43290 WP_001180878.1.43292 WP_001180878.1.43307 WP_001180878.1.43513 WP_001180878.1.43633 WP_001180878.1.43637 WP_001180878.1.43651 WP_001180878.1.43722 WP_001180878.1.43801 WP_001180878.1.43812 WP_001180878.1.43878 WP_001180878.1.43888 WP_001180878.1.43919 WP_001180878.1.43974 WP_001180878.1.44049 WP_001180878.1.44101 WP_001180878.1.44160 WP_001180878.1.44180 WP_001180878.1.44196 WP_001180878.1.44248 WP_001180878.1.44262 WP_001180878.1.44268 WP_001180878.1.4427 WP_001180878.1.44296 WP_001180878.1.44343 WP_001180878.1.44351 WP_001180878.1.44360 WP_001180878.1.44416 WP_001180878.1.44431 WP_001180878.1.44437 WP_001180878.1.44546 WP_001180878.1.4468 WP_001180878.1.44762 WP_001180878.1.44815 WP_001180878.1.44828 WP_001180878.1.44879 WP_001180878.1.44917 WP_001180878.1.4501 WP_001180878.1.45072 WP_001180878.1.45093 WP_001180878.1.45136 WP_001180878.1.45241 WP_001180878.1.45435 WP_001180878.1.45523 WP_001180878.1.45596 WP_001180878.1.45648 WP_001180878.1.45829 WP_001180878.1.45871 WP_001180878.1.46030 WP_001180878.1.46077 WP_001180878.1.46169 WP_001180878.1.46225 WP_001180878.1.46241 WP_001180878.1.46307 WP_001180878.1.46355 WP_001180878.1.464 WP_001180878.1.46454 WP_001180878.1.46461 WP_001180878.1.46504 WP_001180878.1.46505 WP_001180878.1.46551 WP_001180878.1.46559 WP_001180878.1.46701 WP_001180878.1.46781 WP_001180878.1.46842 WP_001180878.1.4690 WP_001180878.1.46945 WP_001180878.1.47036 WP_001180878.1.47037 WP_001180878.1.47042 WP_001180878.1.47059 WP_001180878.1.47085 WP_001180878.1.47123 WP_001180878.1.47215 WP_001180878.1.47245 WP_001180878.1.47523 WP_001180878.1.47531 WP_001180878.1.47532 WP_001180878.1.47605 WP_001180878.1.47630 WP_001180878.1.4774 WP_001180878.1.47756 WP_001180878.1.4781 WP_001180878.1.47886 WP_001180878.1.47898 WP_001180878.1.48019 WP_001180878.1.48100 WP_001180878.1.48114 WP_001180878.1.48139 WP_001180878.1.48190 WP_001180878.1.48292 WP_001180878.1.48324 WP_001180878.1.48426 WP_001180878.1.48430 WP_001180878.1.48436 WP_001180878.1.48586 WP_001180878.1.4859 WP_001180878.1.48591 WP_001180878.1.48610 WP_001180878.1.48631 WP_001180878.1.48663 WP_001180878.1.48690 WP_001180878.1.48734 WP_001180878.1.48756 WP_001180878.1.48778 WP_001180878.1.48849 WP_001180878.1.48955 WP_001180878.1.48963 WP_001180878.1.48973 WP_001180878.1.49004 WP_001180878.1.49106 WP_001180878.1.49117 WP_001180878.1.49121 WP_001180878.1.4914 WP_001180878.1.49140 WP_001180878.1.49153 WP_001180878.1.49166 WP_001180878.1.49355 WP_001180878.1.49429 WP_001180878.1.49434 WP_001180878.1.49450 WP_001180878.1.495 WP_001180878.1.49545 WP_001180878.1.49703 WP_001180878.1.49769 WP_001180878.1.49846 WP_001180878.1.4991 WP_001180878.1.49947 WP_001180878.1.49959 WP_001180878.1.49997 WP_001180878.1.50014 WP_001180878.1.50030 WP_001180878.1.50043 WP_001180878.1.50103 WP_001180878.1.50158 WP_001180878.1.50247 WP_001180878.1.50308 WP_001180878.1.50309 WP_001180878.1.50387 WP_001180878.1.50406 WP_001180878.1.50468 WP_001180878.1.50566 WP_001180878.1.50570 WP_001180878.1.50626 WP_001180878.1.50726 WP_001180878.1.50771 WP_001180878.1.50875 WP_001180878.1.50885 WP_001180878.1.509 WP_001180878.1.50929 WP_001180878.1.50970 WP_001180878.1.51040 WP_001180878.1.51048 WP_001180878.1.51100 WP_001180878.1.51134 WP_001180878.1.51227 WP_001180878.1.5127 WP_001180878.1.51305 WP_001180878.1.51315 WP_001180878.1.5136 WP_001180878.1.51474 WP_001180878.1.51519 WP_001180878.1.51598 WP_001180878.1.51644 WP_001180878.1.51724 WP_001180878.1.51734 WP_001180878.1.51838 WP_001180878.1.51863 WP_001180878.1.51935 WP_001180878.1.52057 WP_001180878.1.52114 WP_001180878.1.52129 WP_001180878.1.52191 WP_001180878.1.52202 WP_001180878.1.52209 WP_001180878.1.52339 WP_001180878.1.52469 WP_001180878.1.52571 WP_001180878.1.526 WP_001180878.1.52647 WP_001180878.1.52742 WP_001180878.1.52773 WP_001180878.1.52795 WP_001180878.1.52807 WP_001180878.1.52887 WP_001180878.1.53092 WP_001180878.1.53141 WP_001180878.1.53151 WP_001180878.1.53154 WP_001180878.1.53159 WP_001180878.1.53233 WP_001180878.1.53307 WP_001180878.1.53321 WP_001180878.1.53368 WP_001180878.1.53375 WP_001180878.1.53450 WP_001180878.1.5349 WP_001180878.1.53540 WP_001180878.1.53555 WP_001180878.1.53559 WP_001180878.1.5356 WP_001180878.1.53571 WP_001180878.1.5358 WP_001180878.1.53692 WP_001180878.1.53723 WP_001180878.1.5374 WP_001180878.1.53750 WP_001180878.1.53800 WP_001180878.1.53815 WP_001180878.1.53839 WP_001180878.1.53892 WP_001180878.1.53898 WP_001180878.1.53902 WP_001180878.1.53958 WP_001180878.1.53981 WP_001180878.1.53984 WP_001180878.1.54132 WP_001180878.1.54170 WP_001180878.1.54175 WP_001180878.1.54203 WP_001180878.1.54259 WP_001180878.1.5430 WP_001180878.1.54371 WP_001180878.1.54431 WP_001180878.1.54442 WP_001180878.1.54482 WP_001180878.1.54589 WP_001180878.1.54667 WP_001180878.1.54678 WP_001180878.1.54681 WP_001180878.1.54748 WP_001180878.1.5481 WP_001180878.1.54865 WP_001180878.1.54935 WP_001180878.1.54979 WP_001180878.1.55010 WP_001180878.1.55034 WP_001180878.1.55163 WP_001180878.1.55165 WP_001180878.1.55215 WP_001180878.1.55290 WP_001180878.1.55310 WP_001180878.1.55317 WP_001180878.1.55379 WP_001180878.1.5539 WP_001180878.1.55468 WP_001180878.1.55506 WP_001180878.1.55604 WP_001180878.1.55639 WP_001180878.1.55699 WP_001180878.1.55725 WP_001180878.1.55780 WP_001180878.1.55967 WP_001180878.1.56144 WP_001180878.1.56172 WP_001180878.1.5621 WP_001180878.1.56226 WP_001180878.1.56311 WP_001180878.1.56419 WP_001180878.1.56423 WP_001180878.1.56514 WP_001180878.1.56535 WP_001180878.1.56585 WP_001180878.1.56640 WP_001180878.1.56724 WP_001180878.1.56825 WP_001180878.1.56887 WP_001180878.1.56889 WP_001180878.1.56981 WP_001180878.1.57101 WP_001180878.1.57137 WP_001180878.1.57147 WP_001180878.1.57179 WP_001180878.1.57186 WP_001180878.1.57342 WP_001180878.1.57684 WP_001180878.1.57699 WP_001180878.1.57785 WP_001180878.1.57873 WP_001180878.1.57965 WP_001180878.1.57972 WP_001180878.1.58008 WP_001180878.1.58044 WP_001180878.1.58081 WP_001180878.1.5809 WP_001180878.1.58173 WP_001180878.1.58191 WP_001180878.1.58194 WP_001180878.1.58252 WP_001180878.1.58261 WP_001180878.1.58274 WP_001180878.1.58282 WP_001180878.1.58324 WP_001180878.1.58326 WP_001180878.1.5836 WP_001180878.1.58485 WP_001180878.1.58537 WP_001180878.1.58568 WP_001180878.1.58583 WP_001180878.1.58652 WP_001180878.1.58663 WP_001180878.1.58724 WP_001180878.1.5875 WP_001180878.1.58796 WP_001180878.1.58807 WP_001180878.1.58847 WP_001180878.1.58883 WP_001180878.1.58898 WP_001180878.1.58949 WP_001180878.1.58963 WP_001180878.1.58970 WP_001180878.1.58974 WP_001180878.1.59020 WP_001180878.1.59043 WP_001180878.1.59056 WP_001180878.1.59061 WP_001180878.1.59064 WP_001180878.1.59282 WP_001180878.1.59299 WP_001180878.1.59313 WP_001180878.1.5949 WP_001180878.1.59501 WP_001180878.1.59510 WP_001180878.1.5969 WP_001180878.1.59751 WP_001180878.1.59827 WP_001180878.1.59829 WP_001180878.1.59847 WP_001180878.1.59863 WP_001180878.1.59969 WP_001180878.1.59994 WP_001180878.1.60045 WP_001180878.1.60076 WP_001180878.1.60114 WP_001180878.1.60154 WP_001180878.1.60168 WP_001180878.1.60192 WP_001180878.1.60199 WP_001180878.1.60212 WP_001180878.1.60253 WP_001180878.1.60322 WP_001180878.1.60324 WP_001180878.1.60356 WP_001180878.1.6038 WP_001180878.1.60380 WP_001180878.1.6041 WP_001180878.1.60424 WP_001180878.1.60481 WP_001180878.1.605 WP_001180878.1.6058 WP_001180878.1.60584 WP_001180878.1.6060 WP_001180878.1.60676 WP_001180878.1.60708 WP_001180878.1.60725 WP_001180878.1.60783 WP_001180878.1.60792 WP_001180878.1.60807 WP_001180878.1.60882 WP_001180878.1.60889 WP_001180878.1.60950 WP_001180878.1.6104 WP_001180878.1.61044 WP_001180878.1.61076 WP_001180878.1.61123 WP_001180878.1.61147 WP_001180878.1.61168 WP_001180878.1.61210 WP_001180878.1.61357 WP_001180878.1.61511 WP_001180878.1.61539 WP_001180878.1.61542 WP_001180878.1.61553 WP_001180878.1.61649 WP_001180878.1.61652 WP_001180878.1.61697 WP_001180878.1.61809 WP_001180878.1.61877 WP_001180878.1.61920 WP_001180878.1.62124 WP_001180878.1.62199 WP_001180878.1.62223 WP_001180878.1.62302 WP_001180878.1.62314 WP_001180878.1.62323 WP_001180878.1.62333 WP_001180878.1.62338 WP_001180878.1.62380 WP_001180878.1.62411 WP_001180878.1.62436 WP_001180878.1.62475 WP_001180878.1.62536 WP_001180878.1.62640 WP_001180878.1.62686 WP_001180878.1.62751 WP_001180878.1.62825 WP_001180878.1.62913 WP_001180878.1.62932 WP_001180878.1.62960 WP_001180878.1.63016 WP_001180878.1.63025 WP_001180878.1.63069 WP_001180878.1.63087 WP_001180878.1.63169 WP_001180878.1.63297 WP_001180878.1.63448 WP_001180878.1.63514 WP_001180878.1.63583 WP_001180878.1.63592 WP_001180878.1.63663 WP_001180878.1.63736 WP_001180878.1.63816 WP_001180878.1.63876 WP_001180878.1.6389 WP_001180878.1.63955 WP_001180878.1.63963 WP_001180878.1.64032 WP_001180878.1.64087 WP_001180878.1.6415 WP_001180878.1.64293 WP_001180878.1.64332 WP_001180878.1.64376 WP_001180878.1.644 WP_001180878.1.64471 WP_001180878.1.64501 WP_001180878.1.64538 WP_001180878.1.64632 WP_001180878.1.64648 WP_001180878.1.64654 WP_001180878.1.64662 WP_001180878.1.64663 WP_001180878.1.64710 WP_001180878.1.64744 WP_001180878.1.64763 WP_001180878.1.64817 WP_001180878.1.6487 WP_001180878.1.64891 WP_001180878.1.64974 WP_001180878.1.65054 WP_001180878.1.65075 WP_001180878.1.65172 WP_001180878.1.65191 WP_001180878.1.65200 WP_001180878.1.65211 WP_001180878.1.65218 WP_001180878.1.65226 WP_001180878.1.65249 WP_001180878.1.65266 WP_001180878.1.65395 WP_001180878.1.65459 WP_001180878.1.65463 WP_001180878.1.65487 WP_001180878.1.6549 WP_001180878.1.65499 WP_001180878.1.6554 WP_001180878.1.65650 WP_001180878.1.65697 WP_001180878.1.65699 WP_001180878.1.65737 WP_001180878.1.65755 WP_001180878.1.65812 WP_001180878.1.65846 WP_001180878.1.65863 WP_001180878.1.65985 WP_001180878.1.66021 WP_001180878.1.66031 WP_001180878.1.66052 WP_001180878.1.66064 WP_001180878.1.66109 WP_001180878.1.66145 WP_001180878.1.66183 WP_001180878.1.6620 WP_001180878.1.66216 WP_001180878.1.66234 WP_001180878.1.66273 WP_001180878.1.66324 WP_001180878.1.6634 WP_001180878.1.66361 WP_001180878.1.66480 WP_001180878.1.66506 WP_001180878.1.66665 WP_001180878.1.66681 WP_001180878.1.66684 WP_001180878.1.66755 WP_001180878.1.66759 WP_001180878.1.66801 WP_001180878.1.66860 WP_001180878.1.66953 WP_001180878.1.66955 WP_001180878.1.66981 WP_001180878.1.67024 WP_001180878.1.67042 WP_001180878.1.67101 WP_001180878.1.67143 WP_001180878.1.67201 WP_001180878.1.67211 WP_001180878.1.67237 WP_001180878.1.67336 WP_001180878.1.67339 WP_001180878.1.67387 WP_001180878.1.67394 WP_001180878.1.67397 WP_001180878.1.67403 WP_001180878.1.67430 WP_001180878.1.67442 WP_001180878.1.67539 WP_001180878.1.67556 WP_001180878.1.67576 WP_001180878.1.67604 WP_001180878.1.67619 WP_001180878.1.67625 WP_001180878.1.67627 WP_001180878.1.67641 WP_001180878.1.67657 WP_001180878.1.67673 WP_001180878.1.67700 WP_001180878.1.67718 WP_001180878.1.67729 WP_001180878.1.67774 WP_001180878.1.67820 WP_001180878.1.67910 WP_001180878.1.67954 WP_001180878.1.68 WP_001180878.1.68043 WP_001180878.1.68105 WP_001180878.1.68113 WP_001180878.1.68131 WP_001180878.1.68182 WP_001180878.1.6819 WP_001180878.1.68285 WP_001180878.1.68359 WP_001180878.1.68420 WP_001180878.1.68514 WP_001180878.1.68564 WP_001180878.1.68688 WP_001180878.1.68742 WP_001180878.1.68770 WP_001180878.1.68809 WP_001180878.1.68914 WP_001180878.1.69053 WP_001180878.1.69170 WP_001180878.1.69210 WP_001180878.1.69270 WP_001180878.1.69282 WP_001180878.1.69376 WP_001180878.1.69396 WP_001180878.1.69466 WP_001180878.1.69611 WP_001180878.1.69642 WP_001180878.1.69656 WP_001180878.1.69657 WP_001180878.1.69690 WP_001180878.1.69923 WP_001180878.1.69948 WP_001180878.1.69953 WP_001180878.1.70010 WP_001180878.1.70049 WP_001180878.1.70058 WP_001180878.1.70061 WP_001180878.1.70205 WP_001180878.1.70240 WP_001180878.1.70249 WP_001180878.1.70261 WP_001180878.1.70314 WP_001180878.1.7033 WP_001180878.1.70427 WP_001180878.1.70433 WP_001180878.1.70545 WP_001180878.1.70623 WP_001180878.1.70671 WP_001180878.1.70679 WP_001180878.1.70708 WP_001180878.1.70717 WP_001180878.1.70731 WP_001180878.1.70772 WP_001180878.1.70845 WP_001180878.1.70846 WP_001180878.1.70981 WP_001180878.1.70995 WP_001180878.1.71039 WP_001180878.1.71057 WP_001180878.1.71081 WP_001180878.1.71117 WP_001180878.1.71186 WP_001180878.1.71455 WP_001180878.1.71456 WP_001180878.1.71487 WP_001180878.1.71523 WP_001180878.1.71542 WP_001180878.1.71566 WP_001180878.1.71640 WP_001180878.1.71651 WP_001180878.1.71653 WP_001180878.1.71716 WP_001180878.1.71872 WP_001180878.1.71950 WP_001180878.1.71954 WP_001180878.1.71985 WP_001180878.1.72003 WP_001180878.1.72073 WP_001180878.1.72269 WP_001180878.1.72350 WP_001180878.1.72383 WP_001180878.1.72461 WP_001180878.1.72527 WP_001180878.1.7255 WP_001180878.1.72631 WP_001180878.1.72638 WP_001180878.1.72667 WP_001180878.1.72674 WP_001180878.1.72724 WP_001180878.1.72789 WP_001180878.1.72828 WP_001180878.1.72896 WP_001180878.1.72969 WP_001180878.1.72987 WP_001180878.1.73052 WP_001180878.1.7311 WP_001180878.1.73114 WP_001180878.1.73177 WP_001180878.1.73180 WP_001180878.1.73258 WP_001180878.1.73285 WP_001180878.1.7332 WP_001180878.1.7333 WP_001180878.1.73352 WP_001180878.1.73389 WP_001180878.1.73425 WP_001180878.1.73488 WP_001180878.1.73504 WP_001180878.1.7353 WP_001180878.1.73544 WP_001180878.1.73598 WP_001180878.1.7361 WP_001180878.1.73648 WP_001180878.1.73768 WP_001180878.1.73849 WP_001180878.1.73948 WP_001180878.1.73999 WP_001180878.1.74024 WP_001180878.1.74030 WP_001180878.1.74038 WP_001180878.1.74043 WP_001180878.1.74058 WP_001180878.1.74070 WP_001180878.1.74077 WP_001180878.1.74135 WP_001180878.1.74214 WP_001180878.1.74241 WP_001180878.1.74285 WP_001180878.1.7430 WP_001180878.1.74317 WP_001180878.1.74415 WP_001180878.1.74616 WP_001180878.1.74621 WP_001180878.1.74647 WP_001180878.1.74677 WP_001180878.1.74699 WP_001180878.1.74831 WP_001180878.1.74894 WP_001180878.1.74929 WP_001180878.1.74939 WP_001180878.1.74973 WP_001180878.1.7507 WP_001180878.1.75089 WP_001180878.1.75116 WP_001180878.1.75273 WP_001180878.1.75296 WP_001180878.1.75413 WP_001180878.1.75433 WP_001180878.1.75532 WP_001180878.1.75565 WP_001180878.1.75593 WP_001180878.1.75610 WP_001180878.1.75633 WP_001180878.1.75718 WP_001180878.1.75745 WP_001180878.1.75844 WP_001180878.1.75886 WP_001180878.1.75898 WP_001180878.1.76116 WP_001180878.1.76122 WP_001180878.1.76256 WP_001180878.1.76366 WP_001180878.1.76417 WP_001180878.1.7646 WP_001180878.1.76510 WP_001180878.1.76558 WP_001180878.1.76572 WP_001180878.1.76641 WP_001180878.1.76651 WP_001180878.1.76653 WP_001180878.1.76788 WP_001180878.1.76854 WP_001180878.1.76916 WP_001180878.1.76932 WP_001180878.1.76973 WP_001180878.1.76988 WP_001180878.1.77016 WP_001180878.1.77087 WP_001180878.1.77090 WP_001180878.1.77111 WP_001180878.1.77299 WP_001180878.1.77384 WP_001180878.1.77501 WP_001180878.1.77512 WP_001180878.1.77513 WP_001180878.1.77563 WP_001180878.1.77702 WP_001180878.1.77713 WP_001180878.1.77825 WP_001180878.1.77837 WP_001180878.1.77900 WP_001180878.1.77923 WP_001180878.1.77975 WP_001180878.1.78035 WP_001180878.1.78048 WP_001180878.1.78107 WP_001180878.1.78166 WP_001180878.1.78192 WP_001180878.1.78195 WP_001180878.1.78291 WP_001180878.1.78309 WP_001180878.1.78320 WP_001180878.1.78382 WP_001180878.1.78388 WP_001180878.1.78410 WP_001180878.1.7862 WP_001180878.1.78626 WP_001180878.1.78661 WP_001180878.1.78674 WP_001180878.1.78676 WP_001180878.1.78761 WP_001180878.1.789 WP_001180878.1.78993 WP_001180878.1.79012 WP_001180878.1.79069 WP_001180878.1.79074 WP_001180878.1.79098 WP_001180878.1.79155 WP_001180878.1.79164 WP_001180878.1.79204 WP_001180878.1.79280 WP_001180878.1.79397 WP_001180878.1.79456 WP_001180878.1.79532 WP_001180878.1.79547 WP_001180878.1.79654 WP_001180878.1.7970 WP_001180878.1.79722 WP_001180878.1.79772 WP_001180878.1.79916 WP_001180878.1.80065 WP_001180878.1.80103 WP_001180878.1.80273 WP_001180878.1.80282 WP_001180878.1.80354 WP_001180878.1.80368 WP_001180878.1.80386 WP_001180878.1.80400 WP_001180878.1.80462 WP_001180878.1.8049 WP_001180878.1.80492 WP_001180878.1.80569 WP_001180878.1.80664 WP_001180878.1.80696 WP_001180878.1.80984 WP_001180878.1.81131 WP_001180878.1.81187 WP_001180878.1.81262 WP_001180878.1.81268 WP_001180878.1.81269 WP_001180878.1.81271 WP_001180878.1.8131 WP_001180878.1.81333 WP_001180878.1.81342 WP_001180878.1.81364 WP_001180878.1.81494 WP_001180878.1.81557 WP_001180878.1.81676 WP_001180878.1.81681 WP_001180878.1.8170 WP_001180878.1.81763 WP_001180878.1.81855 WP_001180878.1.81921 WP_001180878.1.81931 WP_001180878.1.81936 WP_001180878.1.81949 WP_001180878.1.82070 WP_001180878.1.82076 WP_001180878.1.82131 WP_001180878.1.82156 WP_001180878.1.8218 WP_001180878.1.82180 WP_001180878.1.82201 WP_001180878.1.82214 WP_001180878.1.82225 WP_001180878.1.8240 WP_001180878.1.82408 WP_001180878.1.82416 WP_001180878.1.8242 WP_001180878.1.82456 WP_001180878.1.82465 WP_001180878.1.82473 WP_001180878.1.82553 WP_001180878.1.82646 WP_001180878.1.82670 WP_001180878.1.82731 WP_001180878.1.82812 WP_001180878.1.82850 WP_001180878.1.82872 WP_001180878.1.8294 WP_001180878.1.82959 WP_001180878.1.83007 WP_001180878.1.8304 WP_001180878.1.83180 WP_001180878.1.83229 WP_001180878.1.83235 WP_001180878.1.83290 WP_001180878.1.83333 WP_001180878.1.83657 WP_001180878.1.83677 WP_001180878.1.8375 WP_001180878.1.83923 WP_001180878.1.83994 WP_001180878.1.84 WP_001180878.1.8406 WP_001180878.1.84076 WP_001180878.1.84110 WP_001180878.1.84127 WP_001180878.1.84150 WP_001180878.1.84230 WP_001180878.1.84252 WP_001180878.1.8431 WP_001180878.1.84345 WP_001180878.1.84369 WP_001180878.1.84401 WP_001180878.1.84435 WP_001180878.1.84567 WP_001180878.1.84631 WP_001180878.1.84727 WP_001180878.1.84744 WP_001180878.1.84773 WP_001180878.1.84945 WP_001180878.1.84967 WP_001180878.1.85004 WP_001180878.1.85039 WP_001180878.1.85153 WP_001180878.1.85273 WP_001180878.1.85338 WP_001180878.1.85339 WP_001180878.1.85511 WP_001180878.1.85512 WP_001180878.1.8557 WP_001180878.1.85606 WP_001180878.1.85635 WP_001180878.1.85646 WP_001180878.1.85665 WP_001180878.1.85669 WP_001180878.1.85688 WP_001180878.1.85703 WP_001180878.1.85728 WP_001180878.1.85746 WP_001180878.1.85811 WP_001180878.1.859 WP_001180878.1.85917 WP_001180878.1.8594 WP_001180878.1.85977 WP_001180878.1.860 WP_001180878.1.8605 WP_001180878.1.86084 WP_001180878.1.8610 WP_001180878.1.8614 WP_001180878.1.86156 WP_001180878.1.86323 WP_001180878.1.86342 WP_001180878.1.8640 WP_001180878.1.8642 WP_001180878.1.86426 WP_001180878.1.86489 WP_001180878.1.86530 WP_001180878.1.86663 WP_001180878.1.86770 WP_001180878.1.86794 WP_001180878.1.86800 WP_001180878.1.86811 WP_001180878.1.86815 WP_001180878.1.86945 WP_001180878.1.86989 WP_001180878.1.87023 WP_001180878.1.87034 WP_001180878.1.87041 WP_001180878.1.87136 WP_001180878.1.87155 WP_001180878.1.87258 WP_001180878.1.87293 WP_001180878.1.87420 WP_001180878.1.87528 WP_001180878.1.87560 WP_001180878.1.8760 WP_001180878.1.87600 WP_001180878.1.87609 WP_001180878.1.87612 WP_001180878.1.87615 WP_001180878.1.87653 WP_001180878.1.87659 WP_001180878.1.87698 WP_001180878.1.87706 WP_001180878.1.87739 WP_001180878.1.87741 WP_001180878.1.87742 WP_001180878.1.87852 WP_001180878.1.87949 WP_001180878.1.88025 WP_001180878.1.88026 WP_001180878.1.8805 WP_001180878.1.8806 WP_001180878.1.881 WP_001180878.1.88145 WP_001180878.1.88199 WP_001180878.1.88299 WP_001180878.1.88313 WP_001180878.1.88359 WP_001180878.1.88407 WP_001180878.1.88414 WP_001180878.1.88444 WP_001180878.1.88446 WP_001180878.1.88458 WP_001180878.1.88501 WP_001180878.1.88538 WP_001180878.1.88547 WP_001180878.1.886 WP_001180878.1.88647 WP_001180878.1.88648 WP_001180878.1.88692 WP_001180878.1.88707 WP_001180878.1.88727 WP_001180878.1.88772 WP_001180878.1.88850 WP_001180878.1.8889 WP_001180878.1.88892 WP_001180878.1.88894 WP_001180878.1.89182 WP_001180878.1.89298 WP_001180878.1.89308 WP_001180878.1.89314 WP_001180878.1.89328 WP_001180878.1.89332 WP_001180878.1.89343 WP_001180878.1.89395 WP_001180878.1.8940 WP_001180878.1.89449 WP_001180878.1.8947 WP_001180878.1.89503 WP_001180878.1.89591 WP_001180878.1.89612 WP_001180878.1.89668 WP_001180878.1.89706 WP_001180878.1.89713 WP_001180878.1.89733 WP_001180878.1.89796 WP_001180878.1.89804 WP_001180878.1.89845 WP_001180878.1.89888 WP_001180878.1.89911 WP_001180878.1.8995 WP_001180878.1.89952 WP_001180878.1.90007 WP_001180878.1.9011 WP_001180878.1.90196 WP_001180878.1.90240 WP_001180878.1.90274 WP_001180878.1.90280 WP_001180878.1.90330 WP_001180878.1.90338 WP_001180878.1.90365 WP_001180878.1.90428 WP_001180878.1.90489 WP_001180878.1.90513 WP_001180878.1.90582 WP_001180878.1.90713 WP_001180878.1.90794 WP_001180878.1.90796 WP_001180878.1.90811 WP_001180878.1.9091 WP_001180878.1.91067 WP_001180878.1.91164 WP_001180878.1.91205 WP_001180878.1.91239 WP_001180878.1.91291 WP_001180878.1.91313 WP_001180878.1.9135 WP_001180878.1.91506 WP_001180878.1.91557 WP_001180878.1.91597 WP_001180878.1.91715 WP_001180878.1.9187 WP_001180878.1.91870 WP_001180878.1.92018 WP_001180878.1.92087 WP_001180878.1.92098 WP_001180878.1.92156 WP_001180878.1.92172 WP_001180878.1.92240 WP_001180878.1.92243 WP_001180878.1.92327 WP_001180878.1.92470 WP_001180878.1.92477 WP_001180878.1.92545 WP_001180878.1.92570 WP_001180878.1.92588 WP_001180878.1.926 WP_001180878.1.92633 WP_001180878.1.92649 WP_001180878.1.92676 WP_001180878.1.92705 WP_001180878.1.9271 WP_001180878.1.92734 WP_001180878.1.92810 WP_001180878.1.92823 WP_001180878.1.92987 WP_001180878.1.93007 WP_001180878.1.93022 WP_001180878.1.93103 WP_001180878.1.93105 WP_001180878.1.93111 WP_001180878.1.93121 WP_001180878.1.93168 WP_001180878.1.93184 WP_001180878.1.93221 WP_001180878.1.93223 WP_001180878.1.93239 WP_001180878.1.93302 WP_001180878.1.9336 WP_001180878.1.93387 WP_001180878.1.93469 WP_001180878.1.93511 WP_001180878.1.93512 WP_001180878.1.93635 WP_001180878.1.93657 WP_001180878.1.9374 WP_001180878.1.9375 WP_001180878.1.93754 WP_001180878.1.93780 WP_001180878.1.93828 WP_001180878.1.93842 WP_001180878.1.93843 WP_001180878.1.93875 WP_001180878.1.93909 WP_001180878.1.93919 WP_001180878.1.93938 WP_001180878.1.93984 WP_001180878.1.9399 WP_001180878.1.94017 WP_001180878.1.94079 WP_001180878.1.94097 WP_001180878.1.94107 WP_001180878.1.94142 WP_001180878.1.94215 WP_001180878.1.94303 WP_001180878.1.94390 WP_001180878.1.94415 WP_001180878.1.94492 WP_001180878.1.94510 WP_001180878.1.94527 WP_001180878.1.94573 WP_001180878.1.94579 WP_001180878.1.94586 WP_001180878.1.94593 WP_001180878.1.94650 WP_001180878.1.94659 WP_001180878.1.94662 WP_001180878.1.94700 WP_001180878.1.94745 WP_001180878.1.94782 WP_001180878.1.94815 WP_001180878.1.94820 WP_001180878.1.94850 WP_001180878.1.94851 WP_001180878.1.94864 WP_001180878.1.94952 WP_001180878.1.95006 WP_001180878.1.95055 WP_001180878.1.95076 WP_001180878.1.95099 WP_001180878.1.95165 WP_001180878.1.95239 WP_001180878.1.95246 WP_001180878.1.9525 WP_001180878.1.95255 WP_001180878.1.95265 WP_001180878.1.95338 WP_001180878.1.95412 WP_001180878.1.95530 WP_001180878.1.95547 WP_001180878.1.95590 WP_001180878.1.95625 WP_001180878.1.95675 WP_001180878.1.95716 WP_001180878.1.95776 WP_001180878.1.95884 WP_001180878.1.95890 WP_001180878.1.95906 WP_001180878.1.96025 WP_001180878.1.96044 WP_001180878.1.96054 WP_001180878.1.96094 WP_001180878.1.96127 WP_001180878.1.96144 WP_001180878.1.96188 WP_001180878.1.96211 WP_001180878.1.96212 WP_001180878.1.96319 WP_001180878.1.9633 WP_001180878.1.96359 WP_001180878.1.96539 WP_001180878.1.96552 WP_001180878.1.96610 WP_001180878.1.96625 WP_001180878.1.96635 WP_001180878.1.9664 WP_001180878.1.96675 WP_001180878.1.9670 WP_001180878.1.96750 WP_001180878.1.96792 WP_001180878.1.96801 WP_001180878.1.96803 WP_001180878.1.96925 WP_001180878.1.96938 WP_001180878.1.96946 WP_001180878.1.96957 WP_001180878.1.96978 WP_001180878.1.97026 WP_001180878.1.97028 WP_001180878.1.97079 WP_001180878.1.97154 WP_001180878.1.97184 WP_001180878.1.97287 WP_001180878.1.97291 WP_001180878.1.97422 WP_001180878.1.97441 WP_001180878.1.97497 WP_001180878.1.97505 WP_001180878.1.97599 WP_001180878.1.97606 WP_001180878.1.97615 WP_001180878.1.97646 WP_001180878.1.97690 WP_001180878.1.97819 WP_001180878.1.97840 WP_001180878.1.97938 WP_001180878.1.97986 WP_001180878.1.98036 WP_001180878.1.98080 WP_001180878.1.98086 WP_001180878.1.98158 WP_001180878.1.98263 WP_001180878.1.98418 WP_001180878.1.98448 WP_001180878.1.98457 WP_001180878.1.9850 WP_001180878.1.98607 WP_001180878.1.98731 WP_001180878.1.98762 WP_001180878.1.9877 WP_001180878.1.98801 WP_001180878.1.98818 WP_001180878.1.99163 WP_001180878.1.99335 WP_001180878.1.99350 WP_001180878.1.99360 WP_001180878.1.99363 WP_001180878.1.99369 WP_001180878.1.99388 WP_001180878.1.99397 WP_001180878.1.99463 WP_001180878.1.99483 WP_001180878.1.99546 WP_001180878.1.99579 WP_001180878.1.99595 WP_001180878.1.99676 WP_001180878.1.99764 WP_001180878.1.99829 WP_001180878.1.99837 WP_001180878.1.99841 WP_001180878.1.9992 WP_001180878.1.99996 209261.t0452 220341.STY2646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]