SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488653073|ref|YP_007924876.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488653073|ref|YP_007924876.1|
Domain Number 1 Region: 185-317
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.8e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0026
Further Details:      
 
Domain Number 2 Region: 9-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.5e-36
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488653073|ref|YP_007924876.1|
Sequence length 317
Comment putative transketolase C-terminal section [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MIKLAPAGLKDDIEMRKVYAGFVAGQIEAGSPIIALEADLMSSMAMDSVARDYPQHVINC
GIMEANVIGTAAGLALTGRKPFVHTFTAFASRRCFDQLFMALDYQRNNVKVIASDAGVTA
CHNGGTHMSFEDMGIVRGLAHSVVLEVTDAVMFANILRQLMDLDGFYWLRTIRKQATSIY
APGSTFTIGKGNVLREGDDITLIANGIMVAEALEAARQLEQEGVSAAVIDMFTLKPIDRM
LVKNYAEKTRRIVTCENHSIHNGLGSAVAEVLVENCPVPMRRVGVKERYGQVGTQDFLQQ
EYGLTAAAIVEAAKSLL
Download sequence
Identical sequences Q8Z519
209261.t0524 220341.STY2570 gi|488653073|ref|YP_007924876.1| gi|29141039|ref|NP_804381.1| AE014613|CDS_595588-596541 AL513382|CDS_2409124-2408171 gi|378958670|ref|YP_005216156.1| NP_456882.1.84458 WP_000593037.1.100008 WP_000593037.1.100036 WP_000593037.1.100079 WP_000593037.1.100196 WP_000593037.1.100284 WP_000593037.1.100313 WP_000593037.1.100314 WP_000593037.1.100321 WP_000593037.1.100354 WP_000593037.1.100421 WP_000593037.1.100446 WP_000593037.1.100450 WP_000593037.1.100592 WP_000593037.1.100610 WP_000593037.1.100732 WP_000593037.1.100733 WP_000593037.1.100739 WP_000593037.1.100764 WP_000593037.1.100799 WP_000593037.1.100941 WP_000593037.1.100953 WP_000593037.1.101011 WP_000593037.1.10108 WP_000593037.1.101226 WP_000593037.1.10124 WP_000593037.1.101271 WP_000593037.1.101312 WP_000593037.1.101322 WP_000593037.1.101374 WP_000593037.1.101616 WP_000593037.1.101890 WP_000593037.1.101941 WP_000593037.1.102050 WP_000593037.1.102087 WP_000593037.1.10338 WP_000593037.1.1038 WP_000593037.1.104 WP_000593037.1.10401 WP_000593037.1.10428 WP_000593037.1.10459 WP_000593037.1.10475 WP_000593037.1.10511 WP_000593037.1.10514 WP_000593037.1.10530 WP_000593037.1.10532 WP_000593037.1.10547 WP_000593037.1.10595 WP_000593037.1.10642 WP_000593037.1.10654 WP_000593037.1.10677 WP_000593037.1.10857 WP_000593037.1.10873 WP_000593037.1.10926 WP_000593037.1.10936 WP_000593037.1.11012 WP_000593037.1.11055 WP_000593037.1.11126 WP_000593037.1.11142 WP_000593037.1.11239 WP_000593037.1.11253 WP_000593037.1.11314 WP_000593037.1.11385 WP_000593037.1.1142 WP_000593037.1.11426 WP_000593037.1.11429 WP_000593037.1.11557 WP_000593037.1.11567 WP_000593037.1.11638 WP_000593037.1.11883 WP_000593037.1.11908 WP_000593037.1.11914 WP_000593037.1.12040 WP_000593037.1.12061 WP_000593037.1.1207 WP_000593037.1.12141 WP_000593037.1.12172 WP_000593037.1.12192 WP_000593037.1.1224 WP_000593037.1.12364 WP_000593037.1.12398 WP_000593037.1.12441 WP_000593037.1.12581 WP_000593037.1.12620 WP_000593037.1.12648 WP_000593037.1.12683 WP_000593037.1.12726 WP_000593037.1.12727 WP_000593037.1.12741 WP_000593037.1.12834 WP_000593037.1.13108 WP_000593037.1.13161 WP_000593037.1.1321 WP_000593037.1.13268 WP_000593037.1.13291 WP_000593037.1.133 WP_000593037.1.13314 WP_000593037.1.13338 WP_000593037.1.13342 WP_000593037.1.13352 WP_000593037.1.13406 WP_000593037.1.13440 WP_000593037.1.13443 WP_000593037.1.13476 WP_000593037.1.13599 WP_000593037.1.13686 WP_000593037.1.1372 WP_000593037.1.13732 WP_000593037.1.1382 WP_000593037.1.1397 WP_000593037.1.13972 WP_000593037.1.140 WP_000593037.1.1401 WP_000593037.1.1408 WP_000593037.1.14089 WP_000593037.1.14099 WP_000593037.1.14120 WP_000593037.1.14123 WP_000593037.1.14150 WP_000593037.1.14191 WP_000593037.1.14197 WP_000593037.1.14280 WP_000593037.1.14333 WP_000593037.1.14399 WP_000593037.1.14444 WP_000593037.1.14467 WP_000593037.1.14474 WP_000593037.1.14500 WP_000593037.1.14526 WP_000593037.1.14550 WP_000593037.1.14575 WP_000593037.1.14701 WP_000593037.1.14703 WP_000593037.1.14719 WP_000593037.1.1473 WP_000593037.1.14765 WP_000593037.1.14810 WP_000593037.1.14877 WP_000593037.1.14894 WP_000593037.1.14930 WP_000593037.1.14947 WP_000593037.1.14948 WP_000593037.1.15184 WP_000593037.1.15244 WP_000593037.1.15265 WP_000593037.1.15362 WP_000593037.1.15415 WP_000593037.1.15423 WP_000593037.1.15433 WP_000593037.1.15439 WP_000593037.1.15487 WP_000593037.1.15535 WP_000593037.1.15581 WP_000593037.1.15597 WP_000593037.1.15710 WP_000593037.1.15717 WP_000593037.1.15905 WP_000593037.1.15912 WP_000593037.1.15970 WP_000593037.1.16046 WP_000593037.1.16051 WP_000593037.1.16058 WP_000593037.1.16150 WP_000593037.1.16155 WP_000593037.1.1626 WP_000593037.1.16264 WP_000593037.1.16344 WP_000593037.1.16452 WP_000593037.1.16461 WP_000593037.1.16462 WP_000593037.1.16465 WP_000593037.1.16522 WP_000593037.1.16588 WP_000593037.1.16658 WP_000593037.1.16666 WP_000593037.1.16673 WP_000593037.1.1674 WP_000593037.1.16767 WP_000593037.1.16781 WP_000593037.1.16879 WP_000593037.1.16893 WP_000593037.1.16905 WP_000593037.1.16948 WP_000593037.1.17049 WP_000593037.1.17058 WP_000593037.1.17078 WP_000593037.1.17202 WP_000593037.1.17219 WP_000593037.1.1722 WP_000593037.1.17302 WP_000593037.1.17308 WP_000593037.1.17368 WP_000593037.1.17405 WP_000593037.1.17406 WP_000593037.1.17513 WP_000593037.1.17543 WP_000593037.1.17563 WP_000593037.1.17578 WP_000593037.1.17622 WP_000593037.1.17659 WP_000593037.1.17667 WP_000593037.1.17686 WP_000593037.1.17741 WP_000593037.1.17840 WP_000593037.1.17956 WP_000593037.1.18005 WP_000593037.1.1801 WP_000593037.1.18021 WP_000593037.1.18099 WP_000593037.1.18124 WP_000593037.1.18144 WP_000593037.1.18173 WP_000593037.1.18270 WP_000593037.1.18280 WP_000593037.1.18328 WP_000593037.1.18358 WP_000593037.1.18370 WP_000593037.1.18406 WP_000593037.1.18474 WP_000593037.1.18513 WP_000593037.1.18610 WP_000593037.1.18678 WP_000593037.1.18722 WP_000593037.1.18766 WP_000593037.1.1880 WP_000593037.1.1885 WP_000593037.1.18860 WP_000593037.1.18922 WP_000593037.1.18959 WP_000593037.1.19001 WP_000593037.1.19006 WP_000593037.1.19044 WP_000593037.1.19084 WP_000593037.1.19187 WP_000593037.1.19228 WP_000593037.1.19288 WP_000593037.1.19300 WP_000593037.1.19422 WP_000593037.1.19454 WP_000593037.1.19456 WP_000593037.1.19496 WP_000593037.1.19535 WP_000593037.1.19538 WP_000593037.1.19589 WP_000593037.1.19663 WP_000593037.1.19686 WP_000593037.1.19731 WP_000593037.1.19794 WP_000593037.1.1992 WP_000593037.1.19999 WP_000593037.1.20254 WP_000593037.1.20255 WP_000593037.1.20296 WP_000593037.1.20339 WP_000593037.1.20419 WP_000593037.1.20465 WP_000593037.1.20492 WP_000593037.1.2053 WP_000593037.1.20635 WP_000593037.1.20718 WP_000593037.1.2073 WP_000593037.1.20740 WP_000593037.1.20828 WP_000593037.1.2087 WP_000593037.1.20883 WP_000593037.1.20947 WP_000593037.1.20953 WP_000593037.1.21010 WP_000593037.1.2106 WP_000593037.1.21062 WP_000593037.1.21144 WP_000593037.1.21162 WP_000593037.1.21184 WP_000593037.1.21185 WP_000593037.1.21366 WP_000593037.1.21492 WP_000593037.1.2166 WP_000593037.1.21674 WP_000593037.1.21946 WP_000593037.1.21966 WP_000593037.1.22064 WP_000593037.1.22118 WP_000593037.1.22126 WP_000593037.1.2216 WP_000593037.1.22208 WP_000593037.1.2227 WP_000593037.1.22373 WP_000593037.1.22476 WP_000593037.1.22614 WP_000593037.1.22652 WP_000593037.1.22683 WP_000593037.1.2284 WP_000593037.1.22895 WP_000593037.1.22926 WP_000593037.1.22943 WP_000593037.1.22967 WP_000593037.1.23040 WP_000593037.1.23058 WP_000593037.1.23218 WP_000593037.1.2331 WP_000593037.1.2332 WP_000593037.1.23340 WP_000593037.1.2336 WP_000593037.1.23365 WP_000593037.1.23412 WP_000593037.1.23426 WP_000593037.1.23492 WP_000593037.1.23515 WP_000593037.1.23548 WP_000593037.1.23571 WP_000593037.1.23604 WP_000593037.1.23679 WP_000593037.1.23728 WP_000593037.1.2375 WP_000593037.1.23783 WP_000593037.1.23786 WP_000593037.1.23787 WP_000593037.1.23801 WP_000593037.1.24028 WP_000593037.1.24061 WP_000593037.1.24083 WP_000593037.1.24117 WP_000593037.1.24125 WP_000593037.1.24138 WP_000593037.1.24153 WP_000593037.1.24291 WP_000593037.1.24322 WP_000593037.1.24355 WP_000593037.1.24375 WP_000593037.1.24400 WP_000593037.1.24420 WP_000593037.1.24619 WP_000593037.1.24643 WP_000593037.1.24688 WP_000593037.1.24716 WP_000593037.1.2481 WP_000593037.1.24832 WP_000593037.1.24964 WP_000593037.1.25017 WP_000593037.1.25032 WP_000593037.1.25041 WP_000593037.1.25053 WP_000593037.1.25140 WP_000593037.1.25185 WP_000593037.1.25196 WP_000593037.1.25210 WP_000593037.1.25219 WP_000593037.1.25304 WP_000593037.1.25374 WP_000593037.1.25475 WP_000593037.1.25490 WP_000593037.1.25508 WP_000593037.1.25512 WP_000593037.1.25603 WP_000593037.1.2562 WP_000593037.1.25666 WP_000593037.1.25807 WP_000593037.1.25821 WP_000593037.1.25833 WP_000593037.1.25835 WP_000593037.1.25882 WP_000593037.1.25911 WP_000593037.1.25962 WP_000593037.1.25963 WP_000593037.1.26001 WP_000593037.1.26027 WP_000593037.1.26107 WP_000593037.1.2615 WP_000593037.1.26217 WP_000593037.1.26230 WP_000593037.1.26232 WP_000593037.1.26272 WP_000593037.1.26286 WP_000593037.1.26288 WP_000593037.1.26394 WP_000593037.1.26491 WP_000593037.1.2654 WP_000593037.1.26554 WP_000593037.1.26636 WP_000593037.1.26689 WP_000593037.1.2679 WP_000593037.1.26908 WP_000593037.1.2692 WP_000593037.1.26928 WP_000593037.1.270 WP_000593037.1.27008 WP_000593037.1.27027 WP_000593037.1.27070 WP_000593037.1.27077 WP_000593037.1.27086 WP_000593037.1.27087 WP_000593037.1.27111 WP_000593037.1.27115 WP_000593037.1.2713 WP_000593037.1.2717 WP_000593037.1.27228 WP_000593037.1.27282 WP_000593037.1.27285 WP_000593037.1.27309 WP_000593037.1.27329 WP_000593037.1.27361 WP_000593037.1.27565 WP_000593037.1.27595 WP_000593037.1.27598 WP_000593037.1.27706 WP_000593037.1.27775 WP_000593037.1.27785 WP_000593037.1.27900 WP_000593037.1.27928 WP_000593037.1.27945 WP_000593037.1.28004 WP_000593037.1.2809 WP_000593037.1.28155 WP_000593037.1.28198 WP_000593037.1.2822 WP_000593037.1.28229 WP_000593037.1.28384 WP_000593037.1.28386 WP_000593037.1.28395 WP_000593037.1.284 WP_000593037.1.2845 WP_000593037.1.28479 WP_000593037.1.28627 WP_000593037.1.28692 WP_000593037.1.2873 WP_000593037.1.28917 WP_000593037.1.28962 WP_000593037.1.29023 WP_000593037.1.29042 WP_000593037.1.2905 WP_000593037.1.2907 WP_000593037.1.29081 WP_000593037.1.29089 WP_000593037.1.29153 WP_000593037.1.29203 WP_000593037.1.29237 WP_000593037.1.29248 WP_000593037.1.29288 WP_000593037.1.29389 WP_000593037.1.29439 WP_000593037.1.2946 WP_000593037.1.29462 WP_000593037.1.29563 WP_000593037.1.29727 WP_000593037.1.29743 WP_000593037.1.29782 WP_000593037.1.29833 WP_000593037.1.29851 WP_000593037.1.29865 WP_000593037.1.29886 WP_000593037.1.29919 WP_000593037.1.2994 WP_000593037.1.29964 WP_000593037.1.29983 WP_000593037.1.30009 WP_000593037.1.30013 WP_000593037.1.3002 WP_000593037.1.30034 WP_000593037.1.30049 WP_000593037.1.30058 WP_000593037.1.30172 WP_000593037.1.30185 WP_000593037.1.30354 WP_000593037.1.30357 WP_000593037.1.30362 WP_000593037.1.3042 WP_000593037.1.30421 WP_000593037.1.30440 WP_000593037.1.30448 WP_000593037.1.30489 WP_000593037.1.30517 WP_000593037.1.30542 WP_000593037.1.30544 WP_000593037.1.30556 WP_000593037.1.30572 WP_000593037.1.30585 WP_000593037.1.30618 WP_000593037.1.30664 WP_000593037.1.30688 WP_000593037.1.30806 WP_000593037.1.30967 WP_000593037.1.31046 WP_000593037.1.31066 WP_000593037.1.31078 WP_000593037.1.31139 WP_000593037.1.31145 WP_000593037.1.31182 WP_000593037.1.31205 WP_000593037.1.3121 WP_000593037.1.31223 WP_000593037.1.31303 WP_000593037.1.3131 WP_000593037.1.31352 WP_000593037.1.31389 WP_000593037.1.31413 WP_000593037.1.31446 WP_000593037.1.31533 WP_000593037.1.31799 WP_000593037.1.31836 WP_000593037.1.31951 WP_000593037.1.32041 WP_000593037.1.32042 WP_000593037.1.3207 WP_000593037.1.32189 WP_000593037.1.32202 WP_000593037.1.32263 WP_000593037.1.32293 WP_000593037.1.32299 WP_000593037.1.32422 WP_000593037.1.32425 WP_000593037.1.32458 WP_000593037.1.32460 WP_000593037.1.32529 WP_000593037.1.32563 WP_000593037.1.32578 WP_000593037.1.32617 WP_000593037.1.3270 WP_000593037.1.32725 WP_000593037.1.32838 WP_000593037.1.32848 WP_000593037.1.32868 WP_000593037.1.3290 WP_000593037.1.32940 WP_000593037.1.32941 WP_000593037.1.3296 WP_000593037.1.32966 WP_000593037.1.32985 WP_000593037.1.33037 WP_000593037.1.3305 WP_000593037.1.33051 WP_000593037.1.33065 WP_000593037.1.33122 WP_000593037.1.3315 WP_000593037.1.33208 WP_000593037.1.33214 WP_000593037.1.33247 WP_000593037.1.33280 WP_000593037.1.33283 WP_000593037.1.33313 WP_000593037.1.33339 WP_000593037.1.33382 WP_000593037.1.33490 WP_000593037.1.33501 WP_000593037.1.33529 WP_000593037.1.33689 WP_000593037.1.3370 WP_000593037.1.33730 WP_000593037.1.33741 WP_000593037.1.33840 WP_000593037.1.3392 WP_000593037.1.33926 WP_000593037.1.33957 WP_000593037.1.33969 WP_000593037.1.34001 WP_000593037.1.34059 WP_000593037.1.34118 WP_000593037.1.34211 WP_000593037.1.34214 WP_000593037.1.34234 WP_000593037.1.34284 WP_000593037.1.34376 WP_000593037.1.34382 WP_000593037.1.34484 WP_000593037.1.34517 WP_000593037.1.34530 WP_000593037.1.34665 WP_000593037.1.34694 WP_000593037.1.34751 WP_000593037.1.34808 WP_000593037.1.34824 WP_000593037.1.34834 WP_000593037.1.34932 WP_000593037.1.34962 WP_000593037.1.35001 WP_000593037.1.35040 WP_000593037.1.35074 WP_000593037.1.35175 WP_000593037.1.35240 WP_000593037.1.35274 WP_000593037.1.35532 WP_000593037.1.35560 WP_000593037.1.3557 WP_000593037.1.35628 WP_000593037.1.3570 WP_000593037.1.35712 WP_000593037.1.35713 WP_000593037.1.35736 WP_000593037.1.35791 WP_000593037.1.35795 WP_000593037.1.35870 WP_000593037.1.35916 WP_000593037.1.35938 WP_000593037.1.35966 WP_000593037.1.36000 WP_000593037.1.36034 WP_000593037.1.36036 WP_000593037.1.36069 WP_000593037.1.36291 WP_000593037.1.36298 WP_000593037.1.36308 WP_000593037.1.36323 WP_000593037.1.36343 WP_000593037.1.36460 WP_000593037.1.3649 WP_000593037.1.36495 WP_000593037.1.36526 WP_000593037.1.36567 WP_000593037.1.36579 WP_000593037.1.36617 WP_000593037.1.36618 WP_000593037.1.36643 WP_000593037.1.36663 WP_000593037.1.36701 WP_000593037.1.36725 WP_000593037.1.36779 WP_000593037.1.36798 WP_000593037.1.36802 WP_000593037.1.36821 WP_000593037.1.36853 WP_000593037.1.36950 WP_000593037.1.37014 WP_000593037.1.37133 WP_000593037.1.37176 WP_000593037.1.37199 WP_000593037.1.37200 WP_000593037.1.37258 WP_000593037.1.37303 WP_000593037.1.37513 WP_000593037.1.37584 WP_000593037.1.37590 WP_000593037.1.37593 WP_000593037.1.37600 WP_000593037.1.37613 WP_000593037.1.37659 WP_000593037.1.37662 WP_000593037.1.37675 WP_000593037.1.37691 WP_000593037.1.37761 WP_000593037.1.37775 WP_000593037.1.37777 WP_000593037.1.378 WP_000593037.1.379 WP_000593037.1.37911 WP_000593037.1.37941 WP_000593037.1.37985 WP_000593037.1.38061 WP_000593037.1.38064 WP_000593037.1.38108 WP_000593037.1.3816 WP_000593037.1.38207 WP_000593037.1.38261 WP_000593037.1.38266 WP_000593037.1.38310 WP_000593037.1.3834 WP_000593037.1.38351 WP_000593037.1.3838 WP_000593037.1.38381 WP_000593037.1.38440 WP_000593037.1.38486 WP_000593037.1.38515 WP_000593037.1.38595 WP_000593037.1.3860 WP_000593037.1.38642 WP_000593037.1.38734 WP_000593037.1.38877 WP_000593037.1.38983 WP_000593037.1.38996 WP_000593037.1.39056 WP_000593037.1.3907 WP_000593037.1.39105 WP_000593037.1.3914 WP_000593037.1.39147 WP_000593037.1.39161 WP_000593037.1.39210 WP_000593037.1.39235 WP_000593037.1.3931 WP_000593037.1.39435 WP_000593037.1.39502 WP_000593037.1.39530 WP_000593037.1.39619 WP_000593037.1.39620 WP_000593037.1.39624 WP_000593037.1.39659 WP_000593037.1.39667 WP_000593037.1.39775 WP_000593037.1.39879 WP_000593037.1.39890 WP_000593037.1.39941 WP_000593037.1.39945 WP_000593037.1.39947 WP_000593037.1.40095 WP_000593037.1.40097 WP_000593037.1.401 WP_000593037.1.40160 WP_000593037.1.40167 WP_000593037.1.40279 WP_000593037.1.40361 WP_000593037.1.4042 WP_000593037.1.40467 WP_000593037.1.40496 WP_000593037.1.40517 WP_000593037.1.40698 WP_000593037.1.40750 WP_000593037.1.40763 WP_000593037.1.40854 WP_000593037.1.4089 WP_000593037.1.40924 WP_000593037.1.40932 WP_000593037.1.40946 WP_000593037.1.41004 WP_000593037.1.4106 WP_000593037.1.41070 WP_000593037.1.41074 WP_000593037.1.41075 WP_000593037.1.41097 WP_000593037.1.41132 WP_000593037.1.41176 WP_000593037.1.41251 WP_000593037.1.41258 WP_000593037.1.41305 WP_000593037.1.41321 WP_000593037.1.41333 WP_000593037.1.41335 WP_000593037.1.4136 WP_000593037.1.41415 WP_000593037.1.41459 WP_000593037.1.41498 WP_000593037.1.41519 WP_000593037.1.41524 WP_000593037.1.41631 WP_000593037.1.41658 WP_000593037.1.41659 WP_000593037.1.41716 WP_000593037.1.41746 WP_000593037.1.41824 WP_000593037.1.41825 WP_000593037.1.41836 WP_000593037.1.41894 WP_000593037.1.41919 WP_000593037.1.41929 WP_000593037.1.4194 WP_000593037.1.42069 WP_000593037.1.42081 WP_000593037.1.42090 WP_000593037.1.42111 WP_000593037.1.42187 WP_000593037.1.42200 WP_000593037.1.42219 WP_000593037.1.42257 WP_000593037.1.42261 WP_000593037.1.42349 WP_000593037.1.42364 WP_000593037.1.42371 WP_000593037.1.42379 WP_000593037.1.42391 WP_000593037.1.42399 WP_000593037.1.42539 WP_000593037.1.42603 WP_000593037.1.42650 WP_000593037.1.4267 WP_000593037.1.42701 WP_000593037.1.42805 WP_000593037.1.42815 WP_000593037.1.42859 WP_000593037.1.4298 WP_000593037.1.43008 WP_000593037.1.43016 WP_000593037.1.43019 WP_000593037.1.43065 WP_000593037.1.43068 WP_000593037.1.43069 WP_000593037.1.43128 WP_000593037.1.43141 WP_000593037.1.43157 WP_000593037.1.43161 WP_000593037.1.43190 WP_000593037.1.43198 WP_000593037.1.4326 WP_000593037.1.43290 WP_000593037.1.43292 WP_000593037.1.43307 WP_000593037.1.43513 WP_000593037.1.43633 WP_000593037.1.43637 WP_000593037.1.43651 WP_000593037.1.43722 WP_000593037.1.43801 WP_000593037.1.43812 WP_000593037.1.43878 WP_000593037.1.43888 WP_000593037.1.43919 WP_000593037.1.43974 WP_000593037.1.44049 WP_000593037.1.44101 WP_000593037.1.44160 WP_000593037.1.44180 WP_000593037.1.44196 WP_000593037.1.44248 WP_000593037.1.44262 WP_000593037.1.44268 WP_000593037.1.4427 WP_000593037.1.44296 WP_000593037.1.44343 WP_000593037.1.44351 WP_000593037.1.44360 WP_000593037.1.44416 WP_000593037.1.44431 WP_000593037.1.44437 WP_000593037.1.44546 WP_000593037.1.4468 WP_000593037.1.44762 WP_000593037.1.44815 WP_000593037.1.44828 WP_000593037.1.44879 WP_000593037.1.44917 WP_000593037.1.4501 WP_000593037.1.45072 WP_000593037.1.45093 WP_000593037.1.45136 WP_000593037.1.45241 WP_000593037.1.45435 WP_000593037.1.45523 WP_000593037.1.45596 WP_000593037.1.45648 WP_000593037.1.45829 WP_000593037.1.45871 WP_000593037.1.46030 WP_000593037.1.46077 WP_000593037.1.46169 WP_000593037.1.46225 WP_000593037.1.46241 WP_000593037.1.46307 WP_000593037.1.46355 WP_000593037.1.464 WP_000593037.1.46454 WP_000593037.1.46461 WP_000593037.1.46504 WP_000593037.1.46505 WP_000593037.1.46551 WP_000593037.1.46559 WP_000593037.1.46701 WP_000593037.1.46781 WP_000593037.1.46816 WP_000593037.1.46842 WP_000593037.1.4690 WP_000593037.1.46945 WP_000593037.1.47036 WP_000593037.1.47037 WP_000593037.1.47042 WP_000593037.1.47059 WP_000593037.1.47085 WP_000593037.1.47123 WP_000593037.1.47215 WP_000593037.1.47245 WP_000593037.1.47523 WP_000593037.1.47531 WP_000593037.1.47532 WP_000593037.1.47605 WP_000593037.1.47630 WP_000593037.1.4774 WP_000593037.1.47756 WP_000593037.1.4781 WP_000593037.1.47886 WP_000593037.1.47898 WP_000593037.1.48019 WP_000593037.1.48100 WP_000593037.1.48114 WP_000593037.1.48139 WP_000593037.1.48190 WP_000593037.1.48292 WP_000593037.1.48324 WP_000593037.1.48426 WP_000593037.1.48430 WP_000593037.1.48436 WP_000593037.1.48586 WP_000593037.1.4859 WP_000593037.1.48591 WP_000593037.1.48610 WP_000593037.1.48631 WP_000593037.1.48663 WP_000593037.1.48690 WP_000593037.1.48734 WP_000593037.1.48756 WP_000593037.1.48778 WP_000593037.1.48849 WP_000593037.1.48955 WP_000593037.1.48963 WP_000593037.1.48973 WP_000593037.1.49004 WP_000593037.1.49106 WP_000593037.1.49117 WP_000593037.1.49121 WP_000593037.1.4914 WP_000593037.1.49140 WP_000593037.1.49153 WP_000593037.1.49166 WP_000593037.1.49355 WP_000593037.1.49429 WP_000593037.1.49434 WP_000593037.1.49450 WP_000593037.1.495 WP_000593037.1.49545 WP_000593037.1.49703 WP_000593037.1.49769 WP_000593037.1.49846 WP_000593037.1.4991 WP_000593037.1.49947 WP_000593037.1.49959 WP_000593037.1.49997 WP_000593037.1.50014 WP_000593037.1.50030 WP_000593037.1.50043 WP_000593037.1.50103 WP_000593037.1.50158 WP_000593037.1.50247 WP_000593037.1.50308 WP_000593037.1.50309 WP_000593037.1.50387 WP_000593037.1.50406 WP_000593037.1.50468 WP_000593037.1.5051 WP_000593037.1.50566 WP_000593037.1.50570 WP_000593037.1.50626 WP_000593037.1.50726 WP_000593037.1.50771 WP_000593037.1.50875 WP_000593037.1.50885 WP_000593037.1.509 WP_000593037.1.50929 WP_000593037.1.50970 WP_000593037.1.51040 WP_000593037.1.51048 WP_000593037.1.51100 WP_000593037.1.51134 WP_000593037.1.51227 WP_000593037.1.5127 WP_000593037.1.51305 WP_000593037.1.51315 WP_000593037.1.5136 WP_000593037.1.51474 WP_000593037.1.51519 WP_000593037.1.51598 WP_000593037.1.51644 WP_000593037.1.51724 WP_000593037.1.51734 WP_000593037.1.51838 WP_000593037.1.51863 WP_000593037.1.51935 WP_000593037.1.52057 WP_000593037.1.52114 WP_000593037.1.52129 WP_000593037.1.52191 WP_000593037.1.52202 WP_000593037.1.52209 WP_000593037.1.52339 WP_000593037.1.52469 WP_000593037.1.52571 WP_000593037.1.526 WP_000593037.1.52647 WP_000593037.1.52742 WP_000593037.1.52773 WP_000593037.1.52795 WP_000593037.1.52807 WP_000593037.1.52887 WP_000593037.1.53092 WP_000593037.1.53141 WP_000593037.1.53151 WP_000593037.1.53154 WP_000593037.1.53159 WP_000593037.1.53210 WP_000593037.1.53233 WP_000593037.1.53307 WP_000593037.1.53321 WP_000593037.1.53368 WP_000593037.1.53375 WP_000593037.1.53450 WP_000593037.1.5349 WP_000593037.1.53540 WP_000593037.1.53555 WP_000593037.1.53559 WP_000593037.1.5356 WP_000593037.1.53571 WP_000593037.1.5358 WP_000593037.1.53692 WP_000593037.1.53723 WP_000593037.1.5374 WP_000593037.1.53750 WP_000593037.1.53800 WP_000593037.1.53815 WP_000593037.1.53839 WP_000593037.1.53892 WP_000593037.1.53898 WP_000593037.1.53902 WP_000593037.1.53958 WP_000593037.1.53981 WP_000593037.1.53984 WP_000593037.1.54132 WP_000593037.1.54170 WP_000593037.1.54175 WP_000593037.1.54203 WP_000593037.1.54259 WP_000593037.1.5430 WP_000593037.1.54371 WP_000593037.1.54431 WP_000593037.1.54442 WP_000593037.1.54482 WP_000593037.1.54589 WP_000593037.1.54667 WP_000593037.1.54678 WP_000593037.1.54681 WP_000593037.1.54748 WP_000593037.1.5481 WP_000593037.1.54865 WP_000593037.1.54935 WP_000593037.1.54979 WP_000593037.1.55010 WP_000593037.1.55034 WP_000593037.1.55163 WP_000593037.1.55165 WP_000593037.1.55215 WP_000593037.1.55290 WP_000593037.1.55310 WP_000593037.1.55317 WP_000593037.1.55379 WP_000593037.1.5539 WP_000593037.1.55468 WP_000593037.1.55506 WP_000593037.1.55604 WP_000593037.1.55639 WP_000593037.1.55699 WP_000593037.1.55725 WP_000593037.1.55780 WP_000593037.1.55967 WP_000593037.1.56144 WP_000593037.1.56172 WP_000593037.1.5621 WP_000593037.1.56226 WP_000593037.1.56311 WP_000593037.1.56419 WP_000593037.1.56423 WP_000593037.1.56514 WP_000593037.1.56535 WP_000593037.1.56585 WP_000593037.1.56640 WP_000593037.1.56724 WP_000593037.1.56825 WP_000593037.1.56887 WP_000593037.1.56889 WP_000593037.1.56981 WP_000593037.1.57101 WP_000593037.1.57137 WP_000593037.1.57147 WP_000593037.1.57179 WP_000593037.1.57186 WP_000593037.1.57342 WP_000593037.1.57684 WP_000593037.1.57699 WP_000593037.1.57785 WP_000593037.1.57800 WP_000593037.1.57873 WP_000593037.1.57965 WP_000593037.1.57972 WP_000593037.1.58008 WP_000593037.1.58044 WP_000593037.1.58081 WP_000593037.1.5809 WP_000593037.1.58132 WP_000593037.1.58173 WP_000593037.1.58191 WP_000593037.1.58194 WP_000593037.1.58252 WP_000593037.1.58261 WP_000593037.1.58274 WP_000593037.1.58282 WP_000593037.1.58324 WP_000593037.1.58326 WP_000593037.1.5836 WP_000593037.1.58485 WP_000593037.1.58537 WP_000593037.1.58568 WP_000593037.1.58583 WP_000593037.1.58652 WP_000593037.1.58663 WP_000593037.1.58724 WP_000593037.1.5875 WP_000593037.1.58796 WP_000593037.1.58807 WP_000593037.1.58847 WP_000593037.1.58883 WP_000593037.1.58898 WP_000593037.1.58949 WP_000593037.1.58963 WP_000593037.1.58970 WP_000593037.1.58974 WP_000593037.1.59020 WP_000593037.1.59043 WP_000593037.1.59056 WP_000593037.1.59061 WP_000593037.1.59064 WP_000593037.1.59282 WP_000593037.1.59299 WP_000593037.1.59313 WP_000593037.1.5949 WP_000593037.1.59501 WP_000593037.1.59510 WP_000593037.1.5969 WP_000593037.1.59751 WP_000593037.1.59827 WP_000593037.1.59829 WP_000593037.1.59847 WP_000593037.1.59863 WP_000593037.1.59969 WP_000593037.1.59994 WP_000593037.1.60045 WP_000593037.1.60076 WP_000593037.1.60114 WP_000593037.1.60154 WP_000593037.1.60168 WP_000593037.1.60192 WP_000593037.1.60212 WP_000593037.1.60253 WP_000593037.1.60322 WP_000593037.1.60324 WP_000593037.1.60356 WP_000593037.1.6038 WP_000593037.1.60380 WP_000593037.1.6041 WP_000593037.1.60424 WP_000593037.1.60481 WP_000593037.1.605 WP_000593037.1.6058 WP_000593037.1.60584 WP_000593037.1.6060 WP_000593037.1.60676 WP_000593037.1.60708 WP_000593037.1.60725 WP_000593037.1.60783 WP_000593037.1.60792 WP_000593037.1.60807 WP_000593037.1.60882 WP_000593037.1.60889 WP_000593037.1.60950 WP_000593037.1.6104 WP_000593037.1.61044 WP_000593037.1.61076 WP_000593037.1.61123 WP_000593037.1.61147 WP_000593037.1.61168 WP_000593037.1.61210 WP_000593037.1.61357 WP_000593037.1.61511 WP_000593037.1.61539 WP_000593037.1.61542 WP_000593037.1.61553 WP_000593037.1.61649 WP_000593037.1.61652 WP_000593037.1.61697 WP_000593037.1.61809 WP_000593037.1.61877 WP_000593037.1.61920 WP_000593037.1.62124 WP_000593037.1.62199 WP_000593037.1.62223 WP_000593037.1.62302 WP_000593037.1.62314 WP_000593037.1.62323 WP_000593037.1.62333 WP_000593037.1.62338 WP_000593037.1.62380 WP_000593037.1.62411 WP_000593037.1.62436 WP_000593037.1.62475 WP_000593037.1.62536 WP_000593037.1.62640 WP_000593037.1.62686 WP_000593037.1.62751 WP_000593037.1.62825 WP_000593037.1.62913 WP_000593037.1.62932 WP_000593037.1.62960 WP_000593037.1.63016 WP_000593037.1.63025 WP_000593037.1.63069 WP_000593037.1.63087 WP_000593037.1.63169 WP_000593037.1.63297 WP_000593037.1.63448 WP_000593037.1.63514 WP_000593037.1.63583 WP_000593037.1.63592 WP_000593037.1.63663 WP_000593037.1.63736 WP_000593037.1.63816 WP_000593037.1.63876 WP_000593037.1.6389 WP_000593037.1.63901 WP_000593037.1.63955 WP_000593037.1.63963 WP_000593037.1.64032 WP_000593037.1.64087 WP_000593037.1.6415 WP_000593037.1.64293 WP_000593037.1.64332 WP_000593037.1.64376 WP_000593037.1.644 WP_000593037.1.64471 WP_000593037.1.64501 WP_000593037.1.64538 WP_000593037.1.64632 WP_000593037.1.64648 WP_000593037.1.64654 WP_000593037.1.64662 WP_000593037.1.64663 WP_000593037.1.64709 WP_000593037.1.64710 WP_000593037.1.64744 WP_000593037.1.64763 WP_000593037.1.64817 WP_000593037.1.64847 WP_000593037.1.6487 WP_000593037.1.64891 WP_000593037.1.64974 WP_000593037.1.65054 WP_000593037.1.65075 WP_000593037.1.6514 WP_000593037.1.65172 WP_000593037.1.65191 WP_000593037.1.65200 WP_000593037.1.65211 WP_000593037.1.65218 WP_000593037.1.65226 WP_000593037.1.65249 WP_000593037.1.65266 WP_000593037.1.65395 WP_000593037.1.65459 WP_000593037.1.65463 WP_000593037.1.65487 WP_000593037.1.6549 WP_000593037.1.65499 WP_000593037.1.6554 WP_000593037.1.65650 WP_000593037.1.65697 WP_000593037.1.65699 WP_000593037.1.65737 WP_000593037.1.65755 WP_000593037.1.65812 WP_000593037.1.65846 WP_000593037.1.65863 WP_000593037.1.65985 WP_000593037.1.66021 WP_000593037.1.66031 WP_000593037.1.66052 WP_000593037.1.66064 WP_000593037.1.66109 WP_000593037.1.66145 WP_000593037.1.66183 WP_000593037.1.6620 WP_000593037.1.66216 WP_000593037.1.66234 WP_000593037.1.66273 WP_000593037.1.66324 WP_000593037.1.6634 WP_000593037.1.66361 WP_000593037.1.66480 WP_000593037.1.66506 WP_000593037.1.66665 WP_000593037.1.66681 WP_000593037.1.66684 WP_000593037.1.66755 WP_000593037.1.66759 WP_000593037.1.66801 WP_000593037.1.66860 WP_000593037.1.66953 WP_000593037.1.66955 WP_000593037.1.66981 WP_000593037.1.67024 WP_000593037.1.67042 WP_000593037.1.67101 WP_000593037.1.67143 WP_000593037.1.67201 WP_000593037.1.67211 WP_000593037.1.67237 WP_000593037.1.67336 WP_000593037.1.67339 WP_000593037.1.67387 WP_000593037.1.67394 WP_000593037.1.67397 WP_000593037.1.67403 WP_000593037.1.67430 WP_000593037.1.67442 WP_000593037.1.67539 WP_000593037.1.67556 WP_000593037.1.67576 WP_000593037.1.67604 WP_000593037.1.67619 WP_000593037.1.67625 WP_000593037.1.67627 WP_000593037.1.67641 WP_000593037.1.67657 WP_000593037.1.67673 WP_000593037.1.67700 WP_000593037.1.67718 WP_000593037.1.67729 WP_000593037.1.67774 WP_000593037.1.67820 WP_000593037.1.67910 WP_000593037.1.67954 WP_000593037.1.68 WP_000593037.1.68043 WP_000593037.1.68105 WP_000593037.1.68113 WP_000593037.1.68131 WP_000593037.1.68182 WP_000593037.1.6819 WP_000593037.1.68285 WP_000593037.1.68359 WP_000593037.1.68420 WP_000593037.1.68514 WP_000593037.1.68564 WP_000593037.1.68688 WP_000593037.1.68742 WP_000593037.1.68770 WP_000593037.1.68809 WP_000593037.1.68914 WP_000593037.1.69053 WP_000593037.1.69170 WP_000593037.1.69210 WP_000593037.1.69270 WP_000593037.1.69282 WP_000593037.1.69376 WP_000593037.1.69396 WP_000593037.1.69466 WP_000593037.1.69611 WP_000593037.1.69642 WP_000593037.1.69656 WP_000593037.1.69657 WP_000593037.1.69690 WP_000593037.1.69923 WP_000593037.1.69948 WP_000593037.1.69953 WP_000593037.1.70010 WP_000593037.1.70049 WP_000593037.1.70058 WP_000593037.1.70061 WP_000593037.1.70205 WP_000593037.1.70240 WP_000593037.1.70249 WP_000593037.1.70261 WP_000593037.1.70314 WP_000593037.1.7033 WP_000593037.1.70427 WP_000593037.1.70433 WP_000593037.1.70545 WP_000593037.1.70623 WP_000593037.1.70671 WP_000593037.1.70679 WP_000593037.1.70708 WP_000593037.1.70717 WP_000593037.1.70731 WP_000593037.1.70772 WP_000593037.1.70845 WP_000593037.1.70846 WP_000593037.1.70981 WP_000593037.1.70995 WP_000593037.1.71039 WP_000593037.1.71057 WP_000593037.1.71081 WP_000593037.1.71117 WP_000593037.1.71186 WP_000593037.1.71455 WP_000593037.1.71456 WP_000593037.1.71487 WP_000593037.1.71523 WP_000593037.1.71542 WP_000593037.1.71566 WP_000593037.1.71640 WP_000593037.1.71651 WP_000593037.1.71653 WP_000593037.1.71716 WP_000593037.1.71872 WP_000593037.1.71950 WP_000593037.1.71954 WP_000593037.1.71985 WP_000593037.1.72003 WP_000593037.1.72073 WP_000593037.1.72269 WP_000593037.1.72350 WP_000593037.1.72383 WP_000593037.1.72461 WP_000593037.1.72527 WP_000593037.1.7255 WP_000593037.1.72631 WP_000593037.1.72638 WP_000593037.1.72667 WP_000593037.1.72674 WP_000593037.1.72724 WP_000593037.1.72789 WP_000593037.1.72828 WP_000593037.1.72896 WP_000593037.1.72969 WP_000593037.1.72987 WP_000593037.1.73052 WP_000593037.1.7311 WP_000593037.1.73114 WP_000593037.1.73177 WP_000593037.1.73180 WP_000593037.1.73258 WP_000593037.1.73285 WP_000593037.1.7332 WP_000593037.1.7333 WP_000593037.1.73352 WP_000593037.1.73389 WP_000593037.1.73425 WP_000593037.1.73488 WP_000593037.1.73504 WP_000593037.1.7353 WP_000593037.1.73544 WP_000593037.1.73598 WP_000593037.1.7361 WP_000593037.1.73648 WP_000593037.1.73768 WP_000593037.1.73849 WP_000593037.1.73948 WP_000593037.1.73999 WP_000593037.1.74024 WP_000593037.1.74030 WP_000593037.1.74038 WP_000593037.1.74043 WP_000593037.1.74058 WP_000593037.1.74070 WP_000593037.1.74077 WP_000593037.1.74135 WP_000593037.1.74214 WP_000593037.1.74241 WP_000593037.1.74285 WP_000593037.1.7430 WP_000593037.1.74317 WP_000593037.1.74415 WP_000593037.1.74616 WP_000593037.1.74621 WP_000593037.1.74647 WP_000593037.1.74677 WP_000593037.1.74699 WP_000593037.1.74831 WP_000593037.1.74894 WP_000593037.1.74929 WP_000593037.1.74939 WP_000593037.1.74973 WP_000593037.1.7507 WP_000593037.1.75089 WP_000593037.1.75116 WP_000593037.1.75237 WP_000593037.1.75273 WP_000593037.1.75296 WP_000593037.1.75413 WP_000593037.1.75433 WP_000593037.1.75532 WP_000593037.1.75565 WP_000593037.1.75593 WP_000593037.1.75610 WP_000593037.1.75633 WP_000593037.1.75718 WP_000593037.1.75745 WP_000593037.1.75844 WP_000593037.1.75886 WP_000593037.1.75898 WP_000593037.1.76081 WP_000593037.1.76116 WP_000593037.1.76122 WP_000593037.1.76256 WP_000593037.1.76339 WP_000593037.1.76366 WP_000593037.1.76417 WP_000593037.1.7646 WP_000593037.1.76510 WP_000593037.1.76558 WP_000593037.1.76572 WP_000593037.1.76641 WP_000593037.1.76651 WP_000593037.1.76653 WP_000593037.1.76788 WP_000593037.1.76854 WP_000593037.1.76916 WP_000593037.1.76932 WP_000593037.1.76973 WP_000593037.1.76988 WP_000593037.1.77016 WP_000593037.1.77087 WP_000593037.1.77090 WP_000593037.1.77111 WP_000593037.1.77299 WP_000593037.1.77384 WP_000593037.1.77501 WP_000593037.1.77512 WP_000593037.1.77513 WP_000593037.1.77563 WP_000593037.1.77702 WP_000593037.1.77713 WP_000593037.1.7772 WP_000593037.1.77825 WP_000593037.1.77837 WP_000593037.1.77900 WP_000593037.1.77923 WP_000593037.1.77975 WP_000593037.1.78035 WP_000593037.1.78048 WP_000593037.1.78107 WP_000593037.1.78166 WP_000593037.1.78192 WP_000593037.1.78195 WP_000593037.1.78291 WP_000593037.1.78309 WP_000593037.1.78320 WP_000593037.1.78382 WP_000593037.1.78388 WP_000593037.1.78410 WP_000593037.1.7862 WP_000593037.1.78626 WP_000593037.1.78661 WP_000593037.1.78674 WP_000593037.1.78676 WP_000593037.1.78761 WP_000593037.1.789 WP_000593037.1.78993 WP_000593037.1.79012 WP_000593037.1.79069 WP_000593037.1.79074 WP_000593037.1.79098 WP_000593037.1.79155 WP_000593037.1.79164 WP_000593037.1.79204 WP_000593037.1.79280 WP_000593037.1.79397 WP_000593037.1.79456 WP_000593037.1.79532 WP_000593037.1.79547 WP_000593037.1.79654 WP_000593037.1.7970 WP_000593037.1.79722 WP_000593037.1.79772 WP_000593037.1.79880 WP_000593037.1.79916 WP_000593037.1.80065 WP_000593037.1.80103 WP_000593037.1.80273 WP_000593037.1.80282 WP_000593037.1.80354 WP_000593037.1.80368 WP_000593037.1.80386 WP_000593037.1.80400 WP_000593037.1.80462 WP_000593037.1.8049 WP_000593037.1.80492 WP_000593037.1.80569 WP_000593037.1.80664 WP_000593037.1.80696 WP_000593037.1.80984 WP_000593037.1.81131 WP_000593037.1.81187 WP_000593037.1.81262 WP_000593037.1.81268 WP_000593037.1.81269 WP_000593037.1.81271 WP_000593037.1.8131 WP_000593037.1.81333 WP_000593037.1.81342 WP_000593037.1.81364 WP_000593037.1.81494 WP_000593037.1.81557 WP_000593037.1.81676 WP_000593037.1.81681 WP_000593037.1.8170 WP_000593037.1.81763 WP_000593037.1.81855 WP_000593037.1.81921 WP_000593037.1.81931 WP_000593037.1.81936 WP_000593037.1.81949 WP_000593037.1.82070 WP_000593037.1.82076 WP_000593037.1.82131 WP_000593037.1.82156 WP_000593037.1.8218 WP_000593037.1.82180 WP_000593037.1.82201 WP_000593037.1.82214 WP_000593037.1.82225 WP_000593037.1.8240 WP_000593037.1.82408 WP_000593037.1.82416 WP_000593037.1.8242 WP_000593037.1.82456 WP_000593037.1.82465 WP_000593037.1.82473 WP_000593037.1.82553 WP_000593037.1.82646 WP_000593037.1.82670 WP_000593037.1.82731 WP_000593037.1.82812 WP_000593037.1.82850 WP_000593037.1.82872 WP_000593037.1.8294 WP_000593037.1.82959 WP_000593037.1.83007 WP_000593037.1.8304 WP_000593037.1.83180 WP_000593037.1.83229 WP_000593037.1.83235 WP_000593037.1.83290 WP_000593037.1.83333 WP_000593037.1.83657 WP_000593037.1.83677 WP_000593037.1.8375 WP_000593037.1.83923 WP_000593037.1.83994 WP_000593037.1.84 WP_000593037.1.8406 WP_000593037.1.84076 WP_000593037.1.84110 WP_000593037.1.84127 WP_000593037.1.84150 WP_000593037.1.84230 WP_000593037.1.84252 WP_000593037.1.8431 WP_000593037.1.84345 WP_000593037.1.84369 WP_000593037.1.84401 WP_000593037.1.84435 WP_000593037.1.84567 WP_000593037.1.84631 WP_000593037.1.84727 WP_000593037.1.84744 WP_000593037.1.84773 WP_000593037.1.84945 WP_000593037.1.84967 WP_000593037.1.85004 WP_000593037.1.8502 WP_000593037.1.85039 WP_000593037.1.85153 WP_000593037.1.85273 WP_000593037.1.85338 WP_000593037.1.85339 WP_000593037.1.85511 WP_000593037.1.85512 WP_000593037.1.8557 WP_000593037.1.85606 WP_000593037.1.85635 WP_000593037.1.85646 WP_000593037.1.85665 WP_000593037.1.85669 WP_000593037.1.85688 WP_000593037.1.85703 WP_000593037.1.85728 WP_000593037.1.85746 WP_000593037.1.85811 WP_000593037.1.859 WP_000593037.1.85917 WP_000593037.1.8594 WP_000593037.1.85977 WP_000593037.1.860 WP_000593037.1.8605 WP_000593037.1.86084 WP_000593037.1.8610 WP_000593037.1.8614 WP_000593037.1.86156 WP_000593037.1.86323 WP_000593037.1.86342 WP_000593037.1.8640 WP_000593037.1.8642 WP_000593037.1.86426 WP_000593037.1.86489 WP_000593037.1.86530 WP_000593037.1.86663 WP_000593037.1.86770 WP_000593037.1.86794 WP_000593037.1.86800 WP_000593037.1.86811 WP_000593037.1.86815 WP_000593037.1.86945 WP_000593037.1.86989 WP_000593037.1.87023 WP_000593037.1.87034 WP_000593037.1.87041 WP_000593037.1.87155 WP_000593037.1.87258 WP_000593037.1.87293 WP_000593037.1.87420 WP_000593037.1.87528 WP_000593037.1.87560 WP_000593037.1.8760 WP_000593037.1.87600 WP_000593037.1.87609 WP_000593037.1.87612 WP_000593037.1.87615 WP_000593037.1.87653 WP_000593037.1.87659 WP_000593037.1.87698 WP_000593037.1.87706 WP_000593037.1.87739 WP_000593037.1.87741 WP_000593037.1.87742 WP_000593037.1.87852 WP_000593037.1.87949 WP_000593037.1.88025 WP_000593037.1.88026 WP_000593037.1.8805 WP_000593037.1.8806 WP_000593037.1.881 WP_000593037.1.88145 WP_000593037.1.88199 WP_000593037.1.88299 WP_000593037.1.88313 WP_000593037.1.88359 WP_000593037.1.88407 WP_000593037.1.88414 WP_000593037.1.88444 WP_000593037.1.88446 WP_000593037.1.88458 WP_000593037.1.88501 WP_000593037.1.88538 WP_000593037.1.88547 WP_000593037.1.886 WP_000593037.1.88647 WP_000593037.1.88648 WP_000593037.1.88692 WP_000593037.1.88707 WP_000593037.1.88727 WP_000593037.1.88772 WP_000593037.1.88850 WP_000593037.1.8889 WP_000593037.1.88892 WP_000593037.1.88894 WP_000593037.1.89182 WP_000593037.1.89298 WP_000593037.1.89308 WP_000593037.1.89314 WP_000593037.1.89328 WP_000593037.1.89332 WP_000593037.1.89343 WP_000593037.1.89395 WP_000593037.1.8940 WP_000593037.1.89449 WP_000593037.1.8947 WP_000593037.1.89503 WP_000593037.1.89591 WP_000593037.1.89612 WP_000593037.1.89668 WP_000593037.1.89706 WP_000593037.1.89713 WP_000593037.1.89733 WP_000593037.1.89796 WP_000593037.1.89804 WP_000593037.1.89845 WP_000593037.1.89888 WP_000593037.1.89911 WP_000593037.1.8995 WP_000593037.1.89952 WP_000593037.1.90007 WP_000593037.1.9011 WP_000593037.1.90196 WP_000593037.1.90240 WP_000593037.1.90274 WP_000593037.1.90280 WP_000593037.1.90330 WP_000593037.1.90338 WP_000593037.1.90365 WP_000593037.1.90428 WP_000593037.1.90489 WP_000593037.1.90513 WP_000593037.1.90582 WP_000593037.1.90713 WP_000593037.1.90794 WP_000593037.1.90796 WP_000593037.1.90811 WP_000593037.1.9091 WP_000593037.1.91067 WP_000593037.1.91164 WP_000593037.1.91205 WP_000593037.1.91239 WP_000593037.1.91291 WP_000593037.1.91313 WP_000593037.1.9135 WP_000593037.1.91506 WP_000593037.1.91557 WP_000593037.1.91597 WP_000593037.1.91715 WP_000593037.1.9187 WP_000593037.1.91870 WP_000593037.1.92018 WP_000593037.1.92087 WP_000593037.1.92098 WP_000593037.1.92156 WP_000593037.1.92172 WP_000593037.1.92240 WP_000593037.1.92243 WP_000593037.1.92327 WP_000593037.1.92470 WP_000593037.1.92477 WP_000593037.1.92545 WP_000593037.1.92570 WP_000593037.1.92588 WP_000593037.1.926 WP_000593037.1.92633 WP_000593037.1.92649 WP_000593037.1.92676 WP_000593037.1.92705 WP_000593037.1.9271 WP_000593037.1.92734 WP_000593037.1.92810 WP_000593037.1.92823 WP_000593037.1.92987 WP_000593037.1.93007 WP_000593037.1.93022 WP_000593037.1.93103 WP_000593037.1.93105 WP_000593037.1.93111 WP_000593037.1.93121 WP_000593037.1.93168 WP_000593037.1.93184 WP_000593037.1.93221 WP_000593037.1.93223 WP_000593037.1.93239 WP_000593037.1.93302 WP_000593037.1.9336 WP_000593037.1.93387 WP_000593037.1.93469 WP_000593037.1.93511 WP_000593037.1.93512 WP_000593037.1.93635 WP_000593037.1.93657 WP_000593037.1.9374 WP_000593037.1.9375 WP_000593037.1.93754 WP_000593037.1.93780 WP_000593037.1.93828 WP_000593037.1.93842 WP_000593037.1.93843 WP_000593037.1.93875 WP_000593037.1.93909 WP_000593037.1.93919 WP_000593037.1.93938 WP_000593037.1.93984 WP_000593037.1.9399 WP_000593037.1.94017 WP_000593037.1.94079 WP_000593037.1.94097 WP_000593037.1.94107 WP_000593037.1.94142 WP_000593037.1.94215 WP_000593037.1.94303 WP_000593037.1.94365 WP_000593037.1.94390 WP_000593037.1.94415 WP_000593037.1.94492 WP_000593037.1.94510 WP_000593037.1.94527 WP_000593037.1.94573 WP_000593037.1.94579 WP_000593037.1.94586 WP_000593037.1.94593 WP_000593037.1.94650 WP_000593037.1.94659 WP_000593037.1.94662 WP_000593037.1.94700 WP_000593037.1.94745 WP_000593037.1.94782 WP_000593037.1.94815 WP_000593037.1.94820 WP_000593037.1.94850 WP_000593037.1.94851 WP_000593037.1.94864 WP_000593037.1.94952 WP_000593037.1.95006 WP_000593037.1.95055 WP_000593037.1.95076 WP_000593037.1.95099 WP_000593037.1.95165 WP_000593037.1.95239 WP_000593037.1.95246 WP_000593037.1.9525 WP_000593037.1.95255 WP_000593037.1.95265 WP_000593037.1.95338 WP_000593037.1.95412 WP_000593037.1.95530 WP_000593037.1.95547 WP_000593037.1.95590 WP_000593037.1.95625 WP_000593037.1.95675 WP_000593037.1.95716 WP_000593037.1.95776 WP_000593037.1.95884 WP_000593037.1.95890 WP_000593037.1.95906 WP_000593037.1.96025 WP_000593037.1.96044 WP_000593037.1.96054 WP_000593037.1.96094 WP_000593037.1.96127 WP_000593037.1.96144 WP_000593037.1.96188 WP_000593037.1.96211 WP_000593037.1.96212 WP_000593037.1.96319 WP_000593037.1.9633 WP_000593037.1.96359 WP_000593037.1.96539 WP_000593037.1.96552 WP_000593037.1.96610 WP_000593037.1.96625 WP_000593037.1.96635 WP_000593037.1.9664 WP_000593037.1.96675 WP_000593037.1.9670 WP_000593037.1.96750 WP_000593037.1.96792 WP_000593037.1.96801 WP_000593037.1.96803 WP_000593037.1.96925 WP_000593037.1.96938 WP_000593037.1.96946 WP_000593037.1.96957 WP_000593037.1.96978 WP_000593037.1.97026 WP_000593037.1.97028 WP_000593037.1.97079 WP_000593037.1.97154 WP_000593037.1.97184 WP_000593037.1.97287 WP_000593037.1.97291 WP_000593037.1.97422 WP_000593037.1.97441 WP_000593037.1.97497 WP_000593037.1.97505 WP_000593037.1.97599 WP_000593037.1.97606 WP_000593037.1.97615 WP_000593037.1.97646 WP_000593037.1.97690 WP_000593037.1.97819 WP_000593037.1.97840 WP_000593037.1.97938 WP_000593037.1.97986 WP_000593037.1.98036 WP_000593037.1.98080 WP_000593037.1.98086 WP_000593037.1.98158 WP_000593037.1.98263 WP_000593037.1.98418 WP_000593037.1.98448 WP_000593037.1.98457 WP_000593037.1.9850 WP_000593037.1.98502 WP_000593037.1.98607 WP_000593037.1.98731 WP_000593037.1.98762 WP_000593037.1.9877 WP_000593037.1.98801 WP_000593037.1.98818 WP_000593037.1.99163 WP_000593037.1.99335 WP_000593037.1.99350 WP_000593037.1.99360 WP_000593037.1.99363 WP_000593037.1.99369 WP_000593037.1.99388 WP_000593037.1.99397 WP_000593037.1.99463 WP_000593037.1.99483 WP_000593037.1.99546 WP_000593037.1.99579 WP_000593037.1.99595 WP_000593037.1.99671 WP_000593037.1.99676 WP_000593037.1.99764 WP_000593037.1.99829 WP_000593037.1.99837 WP_000593037.1.99841 WP_000593037.1.9992 WP_000593037.1.99996 gi|16761265|ref|NP_456882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]