SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488654644|ref|YP_007926447.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488654644|ref|YP_007926447.1|
Domain Number 1 Region: 120-545
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1e-88
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0065
Further Details:      
 
Domain Number 2 Region: 575-791
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.43e-52
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488654644|ref|YP_007926447.1|
Sequence length 933
Comment 2-oxoglutarate dehydrogenase E1 component [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MQNSALKAWLDSSYLSGSNQSWIEQLYEDFLTDPDSVDANWRLTFQQLPGTGVKPDQLHS
KTREYFRRQALAGSRHSSTISDPDTNVKQVKVLQLINAYRFRGHQHANLDPLGLWKQERV
ADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLDALKQTYCGPIGAEYMHITSTEE
KRWIQQRIESGRAAFSADEKKRFLNELTAAEGLERYLGAKFPGAKRFSLEGGDALIPMLK
EMVRHAGNSGTREVVLGMAHRGRLNVLINVLGKKPQDLFDEFAGKHKEHLGTGDVKYHMG
FSSDIETEGGLVHLALAFNPSHLEIVSPVVMGSVRARLDRLDEPSSNKVLPITIHGDAAV
TGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNPLDARSTPYCTDIGKMVQAPIF
HVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQPLMYQKIKKH
PTPRKIYADKLEADKVATLEDATEMVNLYRDALDAGECVVKEWRPMNMHSFTWSPYLNHE
WDEAYPNKVEMKRLQELAKRISTVPEAIEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLA
YATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQTNGSTYTPLQHIHSGQGQFKVWDSVLS
EEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPH
GYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLVVMSPKS
LLRHPLAVSTLDELANGSFQPAIGEIDELDPKAVKRVVMCSGKVYYDLLEQRRKNDQKDV
AIVRIEQLYPFPHKAVQEALQPYAHVHDFVWCQEEPLNQGAWYCSQHHFREVIPFGAALR
YAGRPASASPAVGYMSVHQKQQQDLVNDALNVD
Download sequence
Identical sequences A0A0L3JHB1 A0A0M0QXL6 A0A0N1QWQ2 A0A1J4QMC3 A0A1R2UW99 A0A1S0ZH96 A0A1S1AK68 A0A1X2UQD5 A0A221YW31 A0A241SGC9 A0A265BBJ0 A0A267SCJ3 A0A271CCI3 A0A271CPS1 A0A2C6FQB3 A0A2D1Y7R8 A0A2I6N1X6 A0A2I6NTQ2 B5EZF9 G4BZ42 G5L6J7 G5ME07 G5N9N1 G5QWS8 G5RSG5 M7S4V2 Q8Z8C6 S4I3Z3 S5HTN0 V1X342 V7IJ01
gi|563652282|ref|YP_008860341.1| gi|537437466|ref|YP_008481843.1| gi|197248575|ref|YP_002145694.1| gi|29142552|ref|NP_805894.1| gi|488654644|ref|YP_007926447.1| gi|198246127|ref|YP_002214704.1| gi|525827300|ref|YP_008249880.1| gi|194736068|ref|YP_002113842.1| gi|452121048|ref|YP_007471296.1| gi|16759675|ref|NP_455292.1| NP_455292.1.84458 WP_001181500.1.100007 WP_001181500.1.100008 WP_001181500.1.100017 WP_001181500.1.100036 WP_001181500.1.100077 WP_001181500.1.100079 WP_001181500.1.100115 WP_001181500.1.100129 WP_001181500.1.10013 WP_001181500.1.100137 WP_001181500.1.100149 WP_001181500.1.100165 WP_001181500.1.100191 WP_001181500.1.100196 WP_001181500.1.1002 WP_001181500.1.100258 WP_001181500.1.100284 WP_001181500.1.100288 WP_001181500.1.100313 WP_001181500.1.100314 WP_001181500.1.100321 WP_001181500.1.100354 WP_001181500.1.100392 WP_001181500.1.100412 WP_001181500.1.100413 WP_001181500.1.100421 WP_001181500.1.100438 WP_001181500.1.100446 WP_001181500.1.100450 WP_001181500.1.100457 WP_001181500.1.100557 WP_001181500.1.100584 WP_001181500.1.100592 WP_001181500.1.100605 WP_001181500.1.100610 WP_001181500.1.100642 WP_001181500.1.10065 WP_001181500.1.100707 WP_001181500.1.100721 WP_001181500.1.100730 WP_001181500.1.100732 WP_001181500.1.100733 WP_001181500.1.100739 WP_001181500.1.10074 WP_001181500.1.100764 WP_001181500.1.100773 WP_001181500.1.100776 WP_001181500.1.100790 WP_001181500.1.100799 WP_001181500.1.10081 WP_001181500.1.100857 WP_001181500.1.100886 WP_001181500.1.100895 WP_001181500.1.100932 WP_001181500.1.100941 WP_001181500.1.100944 WP_001181500.1.100953 WP_001181500.1.101011 WP_001181500.1.10108 WP_001181500.1.101091 WP_001181500.1.101094 WP_001181500.1.101112 WP_001181500.1.101123 WP_001181500.1.101126 WP_001181500.1.101147 WP_001181500.1.101226 WP_001181500.1.10124 WP_001181500.1.101271 WP_001181500.1.1013 WP_001181500.1.101312 WP_001181500.1.101320 WP_001181500.1.101322 WP_001181500.1.101374 WP_001181500.1.101425 WP_001181500.1.101454 WP_001181500.1.101473 WP_001181500.1.101519 WP_001181500.1.101541 WP_001181500.1.101609 WP_001181500.1.101612 WP_001181500.1.101616 WP_001181500.1.101634 WP_001181500.1.101636 WP_001181500.1.101639 WP_001181500.1.10164 WP_001181500.1.101666 WP_001181500.1.101674 WP_001181500.1.101724 WP_001181500.1.101740 WP_001181500.1.101815 WP_001181500.1.101832 WP_001181500.1.101839 WP_001181500.1.101868 WP_001181500.1.101890 WP_001181500.1.101917 WP_001181500.1.101927 WP_001181500.1.101941 WP_001181500.1.101949 WP_001181500.1.101975 WP_001181500.1.102009 WP_001181500.1.102050 WP_001181500.1.102087 WP_001181500.1.102111 WP_001181500.1.10231 WP_001181500.1.10237 WP_001181500.1.10276 WP_001181500.1.10300 WP_001181500.1.10310 WP_001181500.1.10338 WP_001181500.1.1038 WP_001181500.1.104 WP_001181500.1.10401 WP_001181500.1.10428 WP_001181500.1.10459 WP_001181500.1.10463 WP_001181500.1.10465 WP_001181500.1.10475 WP_001181500.1.10498 WP_001181500.1.10507 WP_001181500.1.10511 WP_001181500.1.10514 WP_001181500.1.10530 WP_001181500.1.10532 WP_001181500.1.10547 WP_001181500.1.10566 WP_001181500.1.10568 WP_001181500.1.10595 WP_001181500.1.10631 WP_001181500.1.10642 WP_001181500.1.10654 WP_001181500.1.10677 WP_001181500.1.10711 WP_001181500.1.10720 WP_001181500.1.10755 WP_001181500.1.10797 WP_001181500.1.10857 WP_001181500.1.10868 WP_001181500.1.10873 WP_001181500.1.10898 WP_001181500.1.10926 WP_001181500.1.10936 WP_001181500.1.11000 WP_001181500.1.11012 WP_001181500.1.11041 WP_001181500.1.11055 WP_001181500.1.1110 WP_001181500.1.11119 WP_001181500.1.11126 WP_001181500.1.11142 WP_001181500.1.11156 WP_001181500.1.11213 WP_001181500.1.11216 WP_001181500.1.11239 WP_001181500.1.11253 WP_001181500.1.113 WP_001181500.1.11304 WP_001181500.1.11314 WP_001181500.1.1135 WP_001181500.1.11369 WP_001181500.1.1137 WP_001181500.1.11385 WP_001181500.1.11405 WP_001181500.1.1142 WP_001181500.1.11426 WP_001181500.1.11429 WP_001181500.1.1150 WP_001181500.1.11511 WP_001181500.1.11526 WP_001181500.1.11528 WP_001181500.1.11544 WP_001181500.1.11557 WP_001181500.1.1156 WP_001181500.1.11565 WP_001181500.1.11567 WP_001181500.1.11588 WP_001181500.1.11621 WP_001181500.1.11638 WP_001181500.1.11677 WP_001181500.1.11681 WP_001181500.1.11687 WP_001181500.1.1169 WP_001181500.1.11735 WP_001181500.1.1174 WP_001181500.1.11824 WP_001181500.1.11834 WP_001181500.1.11841 WP_001181500.1.11875 WP_001181500.1.11883 WP_001181500.1.11900 WP_001181500.1.11908 WP_001181500.1.11914 WP_001181500.1.11936 WP_001181500.1.11964 WP_001181500.1.11978 WP_001181500.1.12017 WP_001181500.1.12025 WP_001181500.1.12027 WP_001181500.1.12040 WP_001181500.1.12047 WP_001181500.1.12059 WP_001181500.1.12061 WP_001181500.1.12063 WP_001181500.1.1207 WP_001181500.1.12106 WP_001181500.1.12141 WP_001181500.1.12144 WP_001181500.1.1215 WP_001181500.1.12159 WP_001181500.1.12160 WP_001181500.1.12168 WP_001181500.1.12172 WP_001181500.1.12192 WP_001181500.1.1224 WP_001181500.1.12244 WP_001181500.1.12340 WP_001181500.1.12364 WP_001181500.1.12374 WP_001181500.1.1239 WP_001181500.1.12396 WP_001181500.1.12397 WP_001181500.1.12398 WP_001181500.1.12441 WP_001181500.1.1246 WP_001181500.1.12472 WP_001181500.1.12484 WP_001181500.1.12485 WP_001181500.1.1250 WP_001181500.1.12568 WP_001181500.1.12569 WP_001181500.1.12584 WP_001181500.1.12585 WP_001181500.1.12620 WP_001181500.1.12648 WP_001181500.1.12650 WP_001181500.1.12683 WP_001181500.1.12696 WP_001181500.1.12701 WP_001181500.1.12726 WP_001181500.1.12727 WP_001181500.1.12741 WP_001181500.1.12864 WP_001181500.1.12877 WP_001181500.1.1300 WP_001181500.1.13076 WP_001181500.1.13101 WP_001181500.1.13102 WP_001181500.1.13108 WP_001181500.1.13161 WP_001181500.1.13207 WP_001181500.1.1321 WP_001181500.1.13247 WP_001181500.1.13268 WP_001181500.1.13274 WP_001181500.1.13291 WP_001181500.1.133 WP_001181500.1.13314 WP_001181500.1.13334 WP_001181500.1.13338 WP_001181500.1.13342 WP_001181500.1.13352 WP_001181500.1.13367 WP_001181500.1.13391 WP_001181500.1.13406 WP_001181500.1.13429 WP_001181500.1.13440 WP_001181500.1.13443 WP_001181500.1.13446 WP_001181500.1.1346 WP_001181500.1.13476 WP_001181500.1.13528 WP_001181500.1.13543 WP_001181500.1.13573 WP_001181500.1.13599 WP_001181500.1.13625 WP_001181500.1.13661 WP_001181500.1.13677 WP_001181500.1.13686 WP_001181500.1.13691 WP_001181500.1.1372 WP_001181500.1.13732 WP_001181500.1.13750 WP_001181500.1.13764 WP_001181500.1.13819 WP_001181500.1.1382 WP_001181500.1.13827 WP_001181500.1.13829 WP_001181500.1.13848 WP_001181500.1.13857 WP_001181500.1.1397 WP_001181500.1.13972 WP_001181500.1.140 WP_001181500.1.1401 WP_001181500.1.14011 WP_001181500.1.14050 WP_001181500.1.14056 WP_001181500.1.1408 WP_001181500.1.14089 WP_001181500.1.14099 WP_001181500.1.14111 WP_001181500.1.1412 WP_001181500.1.14120 WP_001181500.1.14123 WP_001181500.1.14150 WP_001181500.1.14191 WP_001181500.1.14197 WP_001181500.1.14212 WP_001181500.1.14280 WP_001181500.1.14296 WP_001181500.1.14333 WP_001181500.1.14369 WP_001181500.1.14399 WP_001181500.1.14436 WP_001181500.1.14444 WP_001181500.1.14446 WP_001181500.1.14458 WP_001181500.1.14467 WP_001181500.1.14474 WP_001181500.1.14495 WP_001181500.1.14500 WP_001181500.1.14516 WP_001181500.1.14526 WP_001181500.1.14528 WP_001181500.1.14550 WP_001181500.1.14575 WP_001181500.1.146 WP_001181500.1.14618 WP_001181500.1.14688 WP_001181500.1.14701 WP_001181500.1.14703 WP_001181500.1.14706 WP_001181500.1.14708 WP_001181500.1.14719 WP_001181500.1.1473 WP_001181500.1.14765 WP_001181500.1.14789 WP_001181500.1.14793 WP_001181500.1.14810 WP_001181500.1.14819 WP_001181500.1.14876 WP_001181500.1.14877 WP_001181500.1.14884 WP_001181500.1.14894 WP_001181500.1.14913 WP_001181500.1.14917 WP_001181500.1.14927 WP_001181500.1.14930 WP_001181500.1.14936 WP_001181500.1.14947 WP_001181500.1.14948 WP_001181500.1.14964 WP_001181500.1.15046 WP_001181500.1.15054 WP_001181500.1.15059 WP_001181500.1.15067 WP_001181500.1.15079 WP_001181500.1.15100 WP_001181500.1.15102 WP_001181500.1.15184 WP_001181500.1.15214 WP_001181500.1.15244 WP_001181500.1.15265 WP_001181500.1.15276 WP_001181500.1.15318 WP_001181500.1.15353 WP_001181500.1.15362 WP_001181500.1.15415 WP_001181500.1.15423 WP_001181500.1.15433 WP_001181500.1.15439 WP_001181500.1.15479 WP_001181500.1.15487 WP_001181500.1.1551 WP_001181500.1.15535 WP_001181500.1.15581 WP_001181500.1.15585 WP_001181500.1.15586 WP_001181500.1.15597 WP_001181500.1.15612 WP_001181500.1.15627 WP_001181500.1.15644 WP_001181500.1.1568 WP_001181500.1.15710 WP_001181500.1.15717 WP_001181500.1.15775 WP_001181500.1.15777 WP_001181500.1.15795 WP_001181500.1.158 WP_001181500.1.15862 WP_001181500.1.15881 WP_001181500.1.15905 WP_001181500.1.15909 WP_001181500.1.15910 WP_001181500.1.15912 WP_001181500.1.1592 WP_001181500.1.15970 WP_001181500.1.15978 WP_001181500.1.15986 WP_001181500.1.15995 WP_001181500.1.16004 WP_001181500.1.1601 WP_001181500.1.16028 WP_001181500.1.16032 WP_001181500.1.16046 WP_001181500.1.16047 WP_001181500.1.16051 WP_001181500.1.16052 WP_001181500.1.16058 WP_001181500.1.16150 WP_001181500.1.16155 WP_001181500.1.16158 WP_001181500.1.16166 WP_001181500.1.16172 WP_001181500.1.16201 WP_001181500.1.1626 WP_001181500.1.16264 WP_001181500.1.16273 WP_001181500.1.16344 WP_001181500.1.16361 WP_001181500.1.16363 WP_001181500.1.16365 WP_001181500.1.16366 WP_001181500.1.16394 WP_001181500.1.16452 WP_001181500.1.16453 WP_001181500.1.16461 WP_001181500.1.16462 WP_001181500.1.16465 WP_001181500.1.16474 WP_001181500.1.16508 WP_001181500.1.16522 WP_001181500.1.16551 WP_001181500.1.16565 WP_001181500.1.16581 WP_001181500.1.16588 WP_001181500.1.16656 WP_001181500.1.16658 WP_001181500.1.16666 WP_001181500.1.16673 WP_001181500.1.1668 WP_001181500.1.167 WP_001181500.1.16729 WP_001181500.1.1674 WP_001181500.1.16767 WP_001181500.1.16781 WP_001181500.1.16804 WP_001181500.1.16817 WP_001181500.1.16819 WP_001181500.1.16826 WP_001181500.1.16846 WP_001181500.1.16855 WP_001181500.1.16873 WP_001181500.1.16879 WP_001181500.1.16893 WP_001181500.1.16903 WP_001181500.1.16905 WP_001181500.1.16910 WP_001181500.1.16942 WP_001181500.1.16948 WP_001181500.1.16972 WP_001181500.1.16998 WP_001181500.1.17049 WP_001181500.1.17058 WP_001181500.1.17060 WP_001181500.1.17078 WP_001181500.1.17093 WP_001181500.1.17096 WP_001181500.1.17098 WP_001181500.1.17105 WP_001181500.1.17202 WP_001181500.1.17219 WP_001181500.1.1722 WP_001181500.1.17270 WP_001181500.1.17302 WP_001181500.1.17308 WP_001181500.1.1733 WP_001181500.1.17368 WP_001181500.1.17405 WP_001181500.1.17406 WP_001181500.1.17439 WP_001181500.1.17482 WP_001181500.1.1749 WP_001181500.1.17504 WP_001181500.1.17513 WP_001181500.1.17525 WP_001181500.1.17543 WP_001181500.1.17560 WP_001181500.1.17563 WP_001181500.1.1757 WP_001181500.1.17578 WP_001181500.1.17583 WP_001181500.1.17622 WP_001181500.1.17629 WP_001181500.1.17659 WP_001181500.1.17667 WP_001181500.1.17686 WP_001181500.1.17693 WP_001181500.1.17703 WP_001181500.1.17732 WP_001181500.1.17741 WP_001181500.1.17743 WP_001181500.1.17840 WP_001181500.1.17886 WP_001181500.1.17891 WP_001181500.1.17901 WP_001181500.1.17914 WP_001181500.1.17919 WP_001181500.1.17936 WP_001181500.1.17949 WP_001181500.1.17956 WP_001181500.1.1798 WP_001181500.1.18005 WP_001181500.1.1801 WP_001181500.1.18021 WP_001181500.1.18022 WP_001181500.1.18056 WP_001181500.1.18061 WP_001181500.1.1807 WP_001181500.1.18092 WP_001181500.1.18099 WP_001181500.1.18103 WP_001181500.1.18109 WP_001181500.1.18122 WP_001181500.1.18124 WP_001181500.1.18144 WP_001181500.1.18149 WP_001181500.1.18173 WP_001181500.1.18178 WP_001181500.1.18192 WP_001181500.1.1825 WP_001181500.1.18254 WP_001181500.1.18270 WP_001181500.1.18277 WP_001181500.1.18280 WP_001181500.1.18282 WP_001181500.1.18328 WP_001181500.1.18358 WP_001181500.1.18370 WP_001181500.1.18384 WP_001181500.1.18406 WP_001181500.1.18426 WP_001181500.1.18441 WP_001181500.1.18445 WP_001181500.1.18474 WP_001181500.1.18485 WP_001181500.1.18489 WP_001181500.1.18513 WP_001181500.1.18610 WP_001181500.1.18641 WP_001181500.1.18678 WP_001181500.1.18686 WP_001181500.1.18688 WP_001181500.1.18722 WP_001181500.1.18737 WP_001181500.1.18766 WP_001181500.1.1880 WP_001181500.1.18847 WP_001181500.1.1885 WP_001181500.1.18860 WP_001181500.1.18886 WP_001181500.1.18895 WP_001181500.1.18919 WP_001181500.1.18922 WP_001181500.1.1895 WP_001181500.1.18959 WP_001181500.1.18972 WP_001181500.1.19001 WP_001181500.1.19006 WP_001181500.1.19030 WP_001181500.1.19038 WP_001181500.1.19044 WP_001181500.1.19055 WP_001181500.1.19064 WP_001181500.1.19084 WP_001181500.1.19093 WP_001181500.1.19163 WP_001181500.1.19174 WP_001181500.1.19187 WP_001181500.1.19228 WP_001181500.1.19273 WP_001181500.1.19288 WP_001181500.1.19291 WP_001181500.1.19300 WP_001181500.1.19340 WP_001181500.1.19357 WP_001181500.1.19373 WP_001181500.1.1939 WP_001181500.1.19405 WP_001181500.1.19422 WP_001181500.1.19433 WP_001181500.1.19454 WP_001181500.1.19456 WP_001181500.1.19469 WP_001181500.1.19496 WP_001181500.1.19535 WP_001181500.1.19538 WP_001181500.1.1954 WP_001181500.1.1955 WP_001181500.1.19588 WP_001181500.1.19589 WP_001181500.1.19616 WP_001181500.1.19656 WP_001181500.1.19663 WP_001181500.1.1968 WP_001181500.1.19683 WP_001181500.1.19686 WP_001181500.1.19723 WP_001181500.1.19731 WP_001181500.1.19740 WP_001181500.1.19793 WP_001181500.1.19794 WP_001181500.1.19823 WP_001181500.1.19834 WP_001181500.1.19851 WP_001181500.1.19884 WP_001181500.1.1990 WP_001181500.1.1992 WP_001181500.1.19967 WP_001181500.1.19970 WP_001181500.1.19975 WP_001181500.1.19987 WP_001181500.1.19999 WP_001181500.1.20023 WP_001181500.1.20081 WP_001181500.1.20086 WP_001181500.1.20089 WP_001181500.1.20218 WP_001181500.1.20254 WP_001181500.1.20255 WP_001181500.1.2026 WP_001181500.1.20261 WP_001181500.1.20296 WP_001181500.1.20330 WP_001181500.1.20339 WP_001181500.1.20349 WP_001181500.1.20364 WP_001181500.1.2041 WP_001181500.1.20415 WP_001181500.1.20419 WP_001181500.1.20437 WP_001181500.1.20446 WP_001181500.1.20465 WP_001181500.1.20488 WP_001181500.1.20492 WP_001181500.1.2053 WP_001181500.1.20573 WP_001181500.1.20614 WP_001181500.1.20631 WP_001181500.1.20635 WP_001181500.1.20700 WP_001181500.1.20718 WP_001181500.1.20721 WP_001181500.1.2073 WP_001181500.1.20740 WP_001181500.1.20767 WP_001181500.1.20787 WP_001181500.1.20789 WP_001181500.1.20795 WP_001181500.1.20810 WP_001181500.1.20828 WP_001181500.1.20862 WP_001181500.1.2087 WP_001181500.1.20883 WP_001181500.1.20900 WP_001181500.1.2091 WP_001181500.1.20947 WP_001181500.1.20953 WP_001181500.1.2101 WP_001181500.1.21010 WP_001181500.1.2106 WP_001181500.1.21062 WP_001181500.1.21079 WP_001181500.1.21089 WP_001181500.1.21103 WP_001181500.1.21136 WP_001181500.1.21144 WP_001181500.1.2116 WP_001181500.1.21162 WP_001181500.1.21165 WP_001181500.1.21181 WP_001181500.1.21184 WP_001181500.1.21185 WP_001181500.1.21194 WP_001181500.1.21202 WP_001181500.1.21241 WP_001181500.1.21260 WP_001181500.1.21286 WP_001181500.1.2130 WP_001181500.1.21309 WP_001181500.1.21326 WP_001181500.1.21332 WP_001181500.1.21351 WP_001181500.1.21362 WP_001181500.1.21366 WP_001181500.1.21399 WP_001181500.1.21404 WP_001181500.1.21443 WP_001181500.1.2146 WP_001181500.1.21473 WP_001181500.1.21492 WP_001181500.1.21548 WP_001181500.1.21616 WP_001181500.1.2166 WP_001181500.1.21674 WP_001181500.1.21681 WP_001181500.1.21692 WP_001181500.1.21715 WP_001181500.1.21750 WP_001181500.1.21825 WP_001181500.1.21845 WP_001181500.1.21877 WP_001181500.1.21886 WP_001181500.1.21909 WP_001181500.1.21910 WP_001181500.1.21940 WP_001181500.1.21946 WP_001181500.1.21950 WP_001181500.1.21981 WP_001181500.1.21991 WP_001181500.1.22019 WP_001181500.1.22030 WP_001181500.1.22051 WP_001181500.1.22064 WP_001181500.1.22096 WP_001181500.1.22117 WP_001181500.1.22118 WP_001181500.1.22126 WP_001181500.1.22136 WP_001181500.1.22158 WP_001181500.1.2216 WP_001181500.1.22162 WP_001181500.1.22169 WP_001181500.1.22205 WP_001181500.1.22208 WP_001181500.1.22235 WP_001181500.1.2227 WP_001181500.1.22296 WP_001181500.1.22315 WP_001181500.1.22346 WP_001181500.1.22373 WP_001181500.1.22388 WP_001181500.1.22449 WP_001181500.1.22453 WP_001181500.1.22454 WP_001181500.1.22460 WP_001181500.1.22476 WP_001181500.1.22537 WP_001181500.1.22565 WP_001181500.1.22590 WP_001181500.1.22595 WP_001181500.1.22604 WP_001181500.1.22605 WP_001181500.1.22614 WP_001181500.1.22623 WP_001181500.1.22652 WP_001181500.1.22676 WP_001181500.1.22683 WP_001181500.1.22692 WP_001181500.1.22758 WP_001181500.1.22760 WP_001181500.1.2284 WP_001181500.1.22845 WP_001181500.1.22855 WP_001181500.1.22857 WP_001181500.1.22864 WP_001181500.1.22880 WP_001181500.1.22895 WP_001181500.1.22902 WP_001181500.1.22926 WP_001181500.1.22943 WP_001181500.1.22947 WP_001181500.1.22966 WP_001181500.1.22967 WP_001181500.1.23010 WP_001181500.1.23040 WP_001181500.1.23058 WP_001181500.1.23080 WP_001181500.1.23175 WP_001181500.1.23201 WP_001181500.1.23218 WP_001181500.1.2324 WP_001181500.1.23246 WP_001181500.1.23274 WP_001181500.1.23279 WP_001181500.1.23309 WP_001181500.1.2331 WP_001181500.1.23311 WP_001181500.1.2332 WP_001181500.1.23329 WP_001181500.1.23343 WP_001181500.1.2336 WP_001181500.1.23365 WP_001181500.1.23379 WP_001181500.1.23409 WP_001181500.1.23412 WP_001181500.1.2342 WP_001181500.1.23426 WP_001181500.1.23442 WP_001181500.1.23485 WP_001181500.1.23492 WP_001181500.1.235 WP_001181500.1.23500 WP_001181500.1.23503 WP_001181500.1.23509 WP_001181500.1.23513 WP_001181500.1.23515 WP_001181500.1.23529 WP_001181500.1.23548 WP_001181500.1.23571 WP_001181500.1.2358 WP_001181500.1.23587 WP_001181500.1.23604 WP_001181500.1.23629 WP_001181500.1.23631 WP_001181500.1.23639 WP_001181500.1.23643 WP_001181500.1.23646 WP_001181500.1.23670 WP_001181500.1.23675 WP_001181500.1.23679 WP_001181500.1.23685 WP_001181500.1.237 WP_001181500.1.23720 WP_001181500.1.23728 WP_001181500.1.23746 WP_001181500.1.2375 WP_001181500.1.23755 WP_001181500.1.2376 WP_001181500.1.23783 WP_001181500.1.23786 WP_001181500.1.23787 WP_001181500.1.2380 WP_001181500.1.23801 WP_001181500.1.23819 WP_001181500.1.23959 WP_001181500.1.24028 WP_001181500.1.24061 WP_001181500.1.24082 WP_001181500.1.24083 WP_001181500.1.24117 WP_001181500.1.24125 WP_001181500.1.24138 WP_001181500.1.24145 WP_001181500.1.24153 WP_001181500.1.24158 WP_001181500.1.24214 WP_001181500.1.24250 WP_001181500.1.24291 WP_001181500.1.24297 WP_001181500.1.24303 WP_001181500.1.24322 WP_001181500.1.24355 WP_001181500.1.24361 WP_001181500.1.24375 WP_001181500.1.24376 WP_001181500.1.24392 WP_001181500.1.24400 WP_001181500.1.24408 WP_001181500.1.24409 WP_001181500.1.24412 WP_001181500.1.24419 WP_001181500.1.24420 WP_001181500.1.24444 WP_001181500.1.24476 WP_001181500.1.24494 WP_001181500.1.24521 WP_001181500.1.24555 WP_001181500.1.24619 WP_001181500.1.24643 WP_001181500.1.2467 WP_001181500.1.24673 WP_001181500.1.24686 WP_001181500.1.24688 WP_001181500.1.24689 WP_001181500.1.24696 WP_001181500.1.24716 WP_001181500.1.24723 WP_001181500.1.24727 WP_001181500.1.24803 WP_001181500.1.2481 WP_001181500.1.24832 WP_001181500.1.24837 WP_001181500.1.24839 WP_001181500.1.24873 WP_001181500.1.24901 WP_001181500.1.24944 WP_001181500.1.24964 WP_001181500.1.24995 WP_001181500.1.25017 WP_001181500.1.25032 WP_001181500.1.25041 WP_001181500.1.25053 WP_001181500.1.25064 WP_001181500.1.25072 WP_001181500.1.25119 WP_001181500.1.25130 WP_001181500.1.25140 WP_001181500.1.25159 WP_001181500.1.25175 WP_001181500.1.25185 WP_001181500.1.25196 WP_001181500.1.25205 WP_001181500.1.25206 WP_001181500.1.25210 WP_001181500.1.25219 WP_001181500.1.25229 WP_001181500.1.25304 WP_001181500.1.25354 WP_001181500.1.25374 WP_001181500.1.25397 WP_001181500.1.25421 WP_001181500.1.25426 WP_001181500.1.25475 WP_001181500.1.25490 WP_001181500.1.25508 WP_001181500.1.25512 WP_001181500.1.25514 WP_001181500.1.25564 WP_001181500.1.25596 WP_001181500.1.25603 WP_001181500.1.25618 WP_001181500.1.2562 WP_001181500.1.25666 WP_001181500.1.2568 WP_001181500.1.25703 WP_001181500.1.25708 WP_001181500.1.25709 WP_001181500.1.25780 WP_001181500.1.25807 WP_001181500.1.2581 WP_001181500.1.25821 WP_001181500.1.25833 WP_001181500.1.25835 WP_001181500.1.25882 WP_001181500.1.25911 WP_001181500.1.25928 WP_001181500.1.25932 WP_001181500.1.25951 WP_001181500.1.25962 WP_001181500.1.25963 WP_001181500.1.26001 WP_001181500.1.26027 WP_001181500.1.26030 WP_001181500.1.26034 WP_001181500.1.26083 WP_001181500.1.26093 WP_001181500.1.26107 WP_001181500.1.26123 WP_001181500.1.26129 WP_001181500.1.2615 WP_001181500.1.26194 WP_001181500.1.26213 WP_001181500.1.26217 WP_001181500.1.26224 WP_001181500.1.26230 WP_001181500.1.26232 WP_001181500.1.26272 WP_001181500.1.26286 WP_001181500.1.26288 WP_001181500.1.2634 WP_001181500.1.26384 WP_001181500.1.26394 WP_001181500.1.26441 WP_001181500.1.26491 WP_001181500.1.26512 WP_001181500.1.26532 WP_001181500.1.2654 WP_001181500.1.26554 WP_001181500.1.26563 WP_001181500.1.26576 WP_001181500.1.26587 WP_001181500.1.2660 WP_001181500.1.26636 WP_001181500.1.26646 WP_001181500.1.26687 WP_001181500.1.26689 WP_001181500.1.26709 WP_001181500.1.2672 WP_001181500.1.26741 WP_001181500.1.2679 WP_001181500.1.26794 WP_001181500.1.26833 WP_001181500.1.26882 WP_001181500.1.26883 WP_001181500.1.26892 WP_001181500.1.26908 WP_001181500.1.26919 WP_001181500.1.2692 WP_001181500.1.26924 WP_001181500.1.26928 WP_001181500.1.26936 WP_001181500.1.26980 WP_001181500.1.270 WP_001181500.1.27008 WP_001181500.1.27027 WP_001181500.1.27051 WP_001181500.1.27070 WP_001181500.1.27072 WP_001181500.1.27077 WP_001181500.1.27084 WP_001181500.1.27086 WP_001181500.1.27087 WP_001181500.1.27111 WP_001181500.1.27115 WP_001181500.1.27122 WP_001181500.1.2713 WP_001181500.1.27169 WP_001181500.1.2717 WP_001181500.1.272 WP_001181500.1.27223 WP_001181500.1.27228 WP_001181500.1.2723 WP_001181500.1.27255 WP_001181500.1.27272 WP_001181500.1.27282 WP_001181500.1.27285 WP_001181500.1.27309 WP_001181500.1.27314 WP_001181500.1.27329 WP_001181500.1.27342 WP_001181500.1.27361 WP_001181500.1.27383 WP_001181500.1.27452 WP_001181500.1.27513 WP_001181500.1.27522 WP_001181500.1.27523 WP_001181500.1.27535 WP_001181500.1.27544 WP_001181500.1.27547 WP_001181500.1.27556 WP_001181500.1.27565 WP_001181500.1.27595 WP_001181500.1.27598 WP_001181500.1.27616 WP_001181500.1.27632 WP_001181500.1.27638 WP_001181500.1.27655 WP_001181500.1.27658 WP_001181500.1.27679 WP_001181500.1.27706 WP_001181500.1.27713 WP_001181500.1.27775 WP_001181500.1.27776 WP_001181500.1.27785 WP_001181500.1.27798 WP_001181500.1.27800 WP_001181500.1.27833 WP_001181500.1.27883 WP_001181500.1.27900 WP_001181500.1.27928 WP_001181500.1.27945 WP_001181500.1.27969 WP_001181500.1.27995 WP_001181500.1.28002 WP_001181500.1.28004 WP_001181500.1.28032 WP_001181500.1.28037 WP_001181500.1.28056 WP_001181500.1.2806 WP_001181500.1.2809 WP_001181500.1.28126 WP_001181500.1.28139 WP_001181500.1.28155 WP_001181500.1.28174 WP_001181500.1.28198 WP_001181500.1.28200 WP_001181500.1.2822 WP_001181500.1.28225 WP_001181500.1.28229 WP_001181500.1.28232 WP_001181500.1.28233 WP_001181500.1.28235 WP_001181500.1.2825 WP_001181500.1.28267 WP_001181500.1.2829 WP_001181500.1.28301 WP_001181500.1.28303 WP_001181500.1.28384 WP_001181500.1.28386 WP_001181500.1.28393 WP_001181500.1.28395 WP_001181500.1.284 WP_001181500.1.2845 WP_001181500.1.28462 WP_001181500.1.28479 WP_001181500.1.28504 WP_001181500.1.2853 WP_001181500.1.28570 WP_001181500.1.28620 WP_001181500.1.28627 WP_001181500.1.28673 WP_001181500.1.28692 WP_001181500.1.287 WP_001181500.1.2873 WP_001181500.1.28773 WP_001181500.1.28775 WP_001181500.1.28776 WP_001181500.1.28811 WP_001181500.1.28917 WP_001181500.1.28921 WP_001181500.1.28948 WP_001181500.1.28962 WP_001181500.1.28963 WP_001181500.1.28977 WP_001181500.1.29023 WP_001181500.1.29042 WP_001181500.1.2905 WP_001181500.1.2907 WP_001181500.1.29081 WP_001181500.1.29089 WP_001181500.1.29099 WP_001181500.1.29113 WP_001181500.1.29130 WP_001181500.1.29153 WP_001181500.1.29168 WP_001181500.1.29174 WP_001181500.1.29190 WP_001181500.1.29203 WP_001181500.1.29218 WP_001181500.1.29237 WP_001181500.1.2924 WP_001181500.1.29248 WP_001181500.1.29255 WP_001181500.1.29265 WP_001181500.1.29274 WP_001181500.1.29288 WP_001181500.1.2932 WP_001181500.1.29349 WP_001181500.1.29379 WP_001181500.1.29389 WP_001181500.1.29422 WP_001181500.1.29436 WP_001181500.1.29439 WP_001181500.1.2946 WP_001181500.1.29462 WP_001181500.1.29509 WP_001181500.1.29530 WP_001181500.1.29563 WP_001181500.1.29576 WP_001181500.1.29593 WP_001181500.1.29682 WP_001181500.1.29711 WP_001181500.1.29727 WP_001181500.1.29732 WP_001181500.1.29743 WP_001181500.1.29768 WP_001181500.1.29774 WP_001181500.1.29775 WP_001181500.1.29782 WP_001181500.1.29827 WP_001181500.1.29833 WP_001181500.1.29865 WP_001181500.1.29886 WP_001181500.1.29919 WP_001181500.1.29923 WP_001181500.1.2994 WP_001181500.1.29964 WP_001181500.1.29983 WP_001181500.1.29990 WP_001181500.1.30009 WP_001181500.1.30013 WP_001181500.1.30018 WP_001181500.1.3002 WP_001181500.1.30022 WP_001181500.1.30034 WP_001181500.1.30049 WP_001181500.1.3005 WP_001181500.1.30058 WP_001181500.1.30059 WP_001181500.1.30086 WP_001181500.1.30165 WP_001181500.1.3017 WP_001181500.1.30170 WP_001181500.1.30172 WP_001181500.1.30179 WP_001181500.1.30185 WP_001181500.1.30202 WP_001181500.1.30210 WP_001181500.1.30225 WP_001181500.1.30278 WP_001181500.1.30331 WP_001181500.1.30354 WP_001181500.1.30356 WP_001181500.1.30357 WP_001181500.1.30362 WP_001181500.1.30386 WP_001181500.1.30389 WP_001181500.1.3042 WP_001181500.1.30421 WP_001181500.1.30425 WP_001181500.1.30437 WP_001181500.1.30440 WP_001181500.1.30448 WP_001181500.1.30489 WP_001181500.1.30492 WP_001181500.1.30517 WP_001181500.1.30542 WP_001181500.1.30544 WP_001181500.1.30548 WP_001181500.1.30556 WP_001181500.1.30572 WP_001181500.1.30585 WP_001181500.1.30589 WP_001181500.1.30602 WP_001181500.1.30618 WP_001181500.1.30619 WP_001181500.1.30627 WP_001181500.1.30635 WP_001181500.1.3066 WP_001181500.1.30664 WP_001181500.1.3067 WP_001181500.1.3068 WP_001181500.1.30688 WP_001181500.1.30696 WP_001181500.1.30752 WP_001181500.1.3076 WP_001181500.1.3080 WP_001181500.1.30802 WP_001181500.1.30806 WP_001181500.1.30819 WP_001181500.1.30823 WP_001181500.1.30967 WP_001181500.1.30968 WP_001181500.1.31001 WP_001181500.1.31011 WP_001181500.1.31042 WP_001181500.1.31046 WP_001181500.1.31066 WP_001181500.1.31078 WP_001181500.1.31086 WP_001181500.1.31092 WP_001181500.1.31111 WP_001181500.1.31139 WP_001181500.1.3114 WP_001181500.1.31145 WP_001181500.1.31155 WP_001181500.1.31156 WP_001181500.1.31167 WP_001181500.1.31182 WP_001181500.1.31198 WP_001181500.1.31205 WP_001181500.1.3121 WP_001181500.1.31214 WP_001181500.1.31219 WP_001181500.1.31222 WP_001181500.1.31223 WP_001181500.1.3124 WP_001181500.1.31262 WP_001181500.1.31272 WP_001181500.1.31303 WP_001181500.1.3131 WP_001181500.1.31335 WP_001181500.1.31352 WP_001181500.1.31389 WP_001181500.1.31413 WP_001181500.1.31435 WP_001181500.1.31446 WP_001181500.1.31451 WP_001181500.1.31533 WP_001181500.1.31585 WP_001181500.1.31665 WP_001181500.1.3167 WP_001181500.1.31725 WP_001181500.1.31782 WP_001181500.1.31799 WP_001181500.1.31836 WP_001181500.1.31845 WP_001181500.1.31854 WP_001181500.1.31895 WP_001181500.1.31927 WP_001181500.1.31951 WP_001181500.1.31952 WP_001181500.1.31983 WP_001181500.1.32006 WP_001181500.1.32038 WP_001181500.1.32041 WP_001181500.1.32042 WP_001181500.1.32054 WP_001181500.1.3207 WP_001181500.1.32109 WP_001181500.1.32116 WP_001181500.1.32170 WP_001181500.1.32189 WP_001181500.1.32202 WP_001181500.1.32204 WP_001181500.1.32252 WP_001181500.1.32260 WP_001181500.1.32263 WP_001181500.1.32274 WP_001181500.1.32275 WP_001181500.1.32293 WP_001181500.1.32299 WP_001181500.1.32309 WP_001181500.1.32357 WP_001181500.1.32368 WP_001181500.1.32408 WP_001181500.1.32422 WP_001181500.1.32423 WP_001181500.1.32424 WP_001181500.1.32425 WP_001181500.1.32458 WP_001181500.1.32459 WP_001181500.1.32460 WP_001181500.1.32491 WP_001181500.1.32519 WP_001181500.1.32527 WP_001181500.1.32529 WP_001181500.1.32545 WP_001181500.1.32563 WP_001181500.1.32578 WP_001181500.1.32617 WP_001181500.1.32624 WP_001181500.1.32643 WP_001181500.1.32668 WP_001181500.1.3270 WP_001181500.1.32725 WP_001181500.1.32740 WP_001181500.1.32750 WP_001181500.1.3278 WP_001181500.1.32832 WP_001181500.1.32838 WP_001181500.1.32848 WP_001181500.1.32860 WP_001181500.1.32868 WP_001181500.1.32881 WP_001181500.1.32899 WP_001181500.1.3290 WP_001181500.1.32900 WP_001181500.1.32902 WP_001181500.1.32930 WP_001181500.1.32940 WP_001181500.1.32941 WP_001181500.1.3296 WP_001181500.1.32966 WP_001181500.1.32977 WP_001181500.1.32985 WP_001181500.1.33010 WP_001181500.1.3305 WP_001181500.1.33051 WP_001181500.1.33065 WP_001181500.1.33078 WP_001181500.1.3310 WP_001181500.1.33106 WP_001181500.1.33122 WP_001181500.1.3315 WP_001181500.1.33160 WP_001181500.1.33208 WP_001181500.1.33214 WP_001181500.1.33247 WP_001181500.1.33253 WP_001181500.1.33270 WP_001181500.1.33280 WP_001181500.1.33283 WP_001181500.1.33313 WP_001181500.1.33339 WP_001181500.1.33382 WP_001181500.1.33392 WP_001181500.1.33409 WP_001181500.1.33486 WP_001181500.1.33490 WP_001181500.1.33499 WP_001181500.1.335 WP_001181500.1.33501 WP_001181500.1.33529 WP_001181500.1.3356 WP_001181500.1.33580 WP_001181500.1.33586 WP_001181500.1.33629 WP_001181500.1.3364 WP_001181500.1.33659 WP_001181500.1.33689 WP_001181500.1.33693 WP_001181500.1.3370 WP_001181500.1.33730 WP_001181500.1.33741 WP_001181500.1.33825 WP_001181500.1.33840 WP_001181500.1.33865 WP_001181500.1.3392 WP_001181500.1.33926 WP_001181500.1.3394 WP_001181500.1.33957 WP_001181500.1.3396 WP_001181500.1.33969 WP_001181500.1.33986 WP_001181500.1.34 WP_001181500.1.34001 WP_001181500.1.34022 WP_001181500.1.34059 WP_001181500.1.34081 WP_001181500.1.34084 WP_001181500.1.34091 WP_001181500.1.34107 WP_001181500.1.34118 WP_001181500.1.34126 WP_001181500.1.34184 WP_001181500.1.34185 WP_001181500.1.34211 WP_001181500.1.34214 WP_001181500.1.34234 WP_001181500.1.34259 WP_001181500.1.34284 WP_001181500.1.34292 WP_001181500.1.34304 WP_001181500.1.34330 WP_001181500.1.34376 WP_001181500.1.3438 WP_001181500.1.34382 WP_001181500.1.34417 WP_001181500.1.34431 WP_001181500.1.34454 WP_001181500.1.34484 WP_001181500.1.34517 WP_001181500.1.34530 WP_001181500.1.34614 WP_001181500.1.34647 WP_001181500.1.34659 WP_001181500.1.34665 WP_001181500.1.34667 WP_001181500.1.34684 WP_001181500.1.34694 WP_001181500.1.34703 WP_001181500.1.34704 WP_001181500.1.34707 WP_001181500.1.34711 WP_001181500.1.34745 WP_001181500.1.34751 WP_001181500.1.3476 WP_001181500.1.34801 WP_001181500.1.34808 WP_001181500.1.34820 WP_001181500.1.34824 WP_001181500.1.34834 WP_001181500.1.34854 WP_001181500.1.34881 WP_001181500.1.34932 WP_001181500.1.34962 WP_001181500.1.34972 WP_001181500.1.34977 WP_001181500.1.35001 WP_001181500.1.35040 WP_001181500.1.35074 WP_001181500.1.35125 WP_001181500.1.35175 WP_001181500.1.35193 WP_001181500.1.35240 WP_001181500.1.35274 WP_001181500.1.35294 WP_001181500.1.35298 WP_001181500.1.35321 WP_001181500.1.35332 WP_001181500.1.3541 WP_001181500.1.35429 WP_001181500.1.35532 WP_001181500.1.3556 WP_001181500.1.35560 WP_001181500.1.35563 WP_001181500.1.3557 WP_001181500.1.35570 WP_001181500.1.35594 WP_001181500.1.35619 WP_001181500.1.35624 WP_001181500.1.35628 WP_001181500.1.35648 WP_001181500.1.3570 WP_001181500.1.35712 WP_001181500.1.35713 WP_001181500.1.3572 WP_001181500.1.35736 WP_001181500.1.35791 WP_001181500.1.35795 WP_001181500.1.35809 WP_001181500.1.35835 WP_001181500.1.35868 WP_001181500.1.35870 WP_001181500.1.35887 WP_001181500.1.35892 WP_001181500.1.35916 WP_001181500.1.35936 WP_001181500.1.35938 WP_001181500.1.35966 WP_001181500.1.35993 WP_001181500.1.36000 WP_001181500.1.36011 WP_001181500.1.36017 WP_001181500.1.36034 WP_001181500.1.36036 WP_001181500.1.36037 WP_001181500.1.36063 WP_001181500.1.36069 WP_001181500.1.36172 WP_001181500.1.36229 WP_001181500.1.36232 WP_001181500.1.36236 WP_001181500.1.36286 WP_001181500.1.36291 WP_001181500.1.36298 WP_001181500.1.36308 WP_001181500.1.36323 WP_001181500.1.36343 WP_001181500.1.36409 WP_001181500.1.36425 WP_001181500.1.36445 WP_001181500.1.36460 WP_001181500.1.3649 WP_001181500.1.36495 WP_001181500.1.36526 WP_001181500.1.36547 WP_001181500.1.36564 WP_001181500.1.36567 WP_001181500.1.36579 WP_001181500.1.36584 WP_001181500.1.36617 WP_001181500.1.36618 WP_001181500.1.36643 WP_001181500.1.36663 WP_001181500.1.36685 WP_001181500.1.36701 WP_001181500.1.36721 WP_001181500.1.36725 WP_001181500.1.36764 WP_001181500.1.36765 WP_001181500.1.36779 WP_001181500.1.36792 WP_001181500.1.36798 WP_001181500.1.36802 WP_001181500.1.36821 WP_001181500.1.36839 WP_001181500.1.36853 WP_001181500.1.36885 WP_001181500.1.36889 WP_001181500.1.36949 WP_001181500.1.36950 WP_001181500.1.36978 WP_001181500.1.37013 WP_001181500.1.37014 WP_001181500.1.37021 WP_001181500.1.37028 WP_001181500.1.37029 WP_001181500.1.37063 WP_001181500.1.37100 WP_001181500.1.37114 WP_001181500.1.37133 WP_001181500.1.37147 WP_001181500.1.37158 WP_001181500.1.37176 WP_001181500.1.37190 WP_001181500.1.37191 WP_001181500.1.37199 WP_001181500.1.37200 WP_001181500.1.37258 WP_001181500.1.3726 WP_001181500.1.37267 WP_001181500.1.3728 WP_001181500.1.37297 WP_001181500.1.37303 WP_001181500.1.3734 WP_001181500.1.37363 WP_001181500.1.37405 WP_001181500.1.37478 WP_001181500.1.3748 WP_001181500.1.3751 WP_001181500.1.37513 WP_001181500.1.37521 WP_001181500.1.37584 WP_001181500.1.37590 WP_001181500.1.37593 WP_001181500.1.37600 WP_001181500.1.37610 WP_001181500.1.37613 WP_001181500.1.37659 WP_001181500.1.37662 WP_001181500.1.37666 WP_001181500.1.37675 WP_001181500.1.37687 WP_001181500.1.37691 WP_001181500.1.3771 WP_001181500.1.37761 WP_001181500.1.37775 WP_001181500.1.37777 WP_001181500.1.3778 WP_001181500.1.378 WP_001181500.1.37848 WP_001181500.1.37864 WP_001181500.1.379 WP_001181500.1.3790 WP_001181500.1.37911 WP_001181500.1.37941 WP_001181500.1.37985 WP_001181500.1.38001 WP_001181500.1.38037 WP_001181500.1.38047 WP_001181500.1.38055 WP_001181500.1.38061 WP_001181500.1.38064 WP_001181500.1.38108 WP_001181500.1.38113 WP_001181500.1.3816 WP_001181500.1.38207 WP_001181500.1.38261 WP_001181500.1.38266 WP_001181500.1.3828 WP_001181500.1.38310 WP_001181500.1.38322 WP_001181500.1.3834 WP_001181500.1.38341 WP_001181500.1.38344 WP_001181500.1.38349 WP_001181500.1.38351 WP_001181500.1.3838 WP_001181500.1.38381 WP_001181500.1.38393 WP_001181500.1.38440 WP_001181500.1.38486 WP_001181500.1.38512 WP_001181500.1.38515 WP_001181500.1.38569 WP_001181500.1.38595 WP_001181500.1.3860 WP_001181500.1.38609 WP_001181500.1.38642 WP_001181500.1.3869 WP_001181500.1.38734 WP_001181500.1.38781 WP_001181500.1.38830 WP_001181500.1.38857 WP_001181500.1.38877 WP_001181500.1.38895 WP_001181500.1.38898 WP_001181500.1.38942 WP_001181500.1.38983 WP_001181500.1.38995 WP_001181500.1.38996 WP_001181500.1.39048 WP_001181500.1.39055 WP_001181500.1.39056 WP_001181500.1.39059 WP_001181500.1.39065 WP_001181500.1.3907 WP_001181500.1.39075 WP_001181500.1.39082 WP_001181500.1.39105 WP_001181500.1.39113 WP_001181500.1.39128 WP_001181500.1.3914 WP_001181500.1.39140 WP_001181500.1.39146 WP_001181500.1.39147 WP_001181500.1.39161 WP_001181500.1.39183 WP_001181500.1.39210 WP_001181500.1.39235 WP_001181500.1.39265 WP_001181500.1.39275 WP_001181500.1.3931 WP_001181500.1.39311 WP_001181500.1.39312 WP_001181500.1.39395 WP_001181500.1.39414 WP_001181500.1.39435 WP_001181500.1.39466 WP_001181500.1.39471 WP_001181500.1.39497 WP_001181500.1.39502 WP_001181500.1.39530 WP_001181500.1.39556 WP_001181500.1.39576 WP_001181500.1.39584 WP_001181500.1.39609 WP_001181500.1.39614 WP_001181500.1.39619 WP_001181500.1.39620 WP_001181500.1.39624 WP_001181500.1.39659 WP_001181500.1.39667 WP_001181500.1.39722 WP_001181500.1.39724 WP_001181500.1.39775 WP_001181500.1.39808 WP_001181500.1.39879 WP_001181500.1.39890 WP_001181500.1.39941 WP_001181500.1.39945 WP_001181500.1.39947 WP_001181500.1.40008 WP_001181500.1.40025 WP_001181500.1.40081 WP_001181500.1.40095 WP_001181500.1.40097 WP_001181500.1.401 WP_001181500.1.40155 WP_001181500.1.40158 WP_001181500.1.40160 WP_001181500.1.40167 WP_001181500.1.40171 WP_001181500.1.40229 WP_001181500.1.40254 WP_001181500.1.40258 WP_001181500.1.40279 WP_001181500.1.40284 WP_001181500.1.40307 WP_001181500.1.40341 WP_001181500.1.40361 WP_001181500.1.40374 WP_001181500.1.4042 WP_001181500.1.40467 WP_001181500.1.40492 WP_001181500.1.40493 WP_001181500.1.40496 WP_001181500.1.40508 WP_001181500.1.40517 WP_001181500.1.40528 WP_001181500.1.40533 WP_001181500.1.40577 WP_001181500.1.40622 WP_001181500.1.40648 WP_001181500.1.40693 WP_001181500.1.40695 WP_001181500.1.40698 WP_001181500.1.40722 WP_001181500.1.40745 WP_001181500.1.40750 WP_001181500.1.40763 WP_001181500.1.40788 WP_001181500.1.40849 WP_001181500.1.40854 WP_001181500.1.4088 WP_001181500.1.4089 WP_001181500.1.40910 WP_001181500.1.40924 WP_001181500.1.40930 WP_001181500.1.40932 WP_001181500.1.40946 WP_001181500.1.40973 WP_001181500.1.40979 WP_001181500.1.40996 WP_001181500.1.41004 WP_001181500.1.41018 WP_001181500.1.41048 WP_001181500.1.41050 WP_001181500.1.4106 WP_001181500.1.41070 WP_001181500.1.41074 WP_001181500.1.41075 WP_001181500.1.4109 WP_001181500.1.41097 WP_001181500.1.41116 WP_001181500.1.41128 WP_001181500.1.41176 WP_001181500.1.41192 WP_001181500.1.41225 WP_001181500.1.41251 WP_001181500.1.41258 WP_001181500.1.41265 WP_001181500.1.41277 WP_001181500.1.41299 WP_001181500.1.41305 WP_001181500.1.41308 WP_001181500.1.41321 WP_001181500.1.41333 WP_001181500.1.41335 WP_001181500.1.41345 WP_001181500.1.4136 WP_001181500.1.4141 WP_001181500.1.41415 WP_001181500.1.41427 WP_001181500.1.41434 WP_001181500.1.41438 WP_001181500.1.41459 WP_001181500.1.41498 WP_001181500.1.41519 WP_001181500.1.41524 WP_001181500.1.41528 WP_001181500.1.41610 WP_001181500.1.41628 WP_001181500.1.41631 WP_001181500.1.41658 WP_001181500.1.41659 WP_001181500.1.41688 WP_001181500.1.41690 WP_001181500.1.41716 WP_001181500.1.41724 WP_001181500.1.41746 WP_001181500.1.41789 WP_001181500.1.41799 WP_001181500.1.41802 WP_001181500.1.41824 WP_001181500.1.41825 WP_001181500.1.41836 WP_001181500.1.4184 WP_001181500.1.41859 WP_001181500.1.41862 WP_001181500.1.41877 WP_001181500.1.41894 WP_001181500.1.41904 WP_001181500.1.41911 WP_001181500.1.41919 WP_001181500.1.41929 WP_001181500.1.41931 WP_001181500.1.41938 WP_001181500.1.4194 WP_001181500.1.41949 WP_001181500.1.41978 WP_001181500.1.41998 WP_001181500.1.42009 WP_001181500.1.42069 WP_001181500.1.42081 WP_001181500.1.42090 WP_001181500.1.42109 WP_001181500.1.42111 WP_001181500.1.42136 WP_001181500.1.42156 WP_001181500.1.42187 WP_001181500.1.422 WP_001181500.1.42200 WP_001181500.1.42219 WP_001181500.1.4222 WP_001181500.1.42243 WP_001181500.1.42244 WP_001181500.1.42248 WP_001181500.1.42257 WP_001181500.1.42261 WP_001181500.1.42263 WP_001181500.1.42322 WP_001181500.1.42328 WP_001181500.1.42349 WP_001181500.1.42356 WP_001181500.1.42371 WP_001181500.1.42379 WP_001181500.1.42391 WP_001181500.1.42392 WP_001181500.1.42399 WP_001181500.1.42404 WP_001181500.1.42433 WP_001181500.1.42444 WP_001181500.1.42453 WP_001181500.1.42491 WP_001181500.1.42539 WP_001181500.1.42595 WP_001181500.1.42603 WP_001181500.1.42605 WP_001181500.1.42650 WP_001181500.1.42655 WP_001181500.1.42666 WP_001181500.1.4267 WP_001181500.1.42676 WP_001181500.1.42683 WP_001181500.1.42701 WP_001181500.1.42707 WP_001181500.1.42734 WP_001181500.1.42794 WP_001181500.1.42805 WP_001181500.1.42815 WP_001181500.1.42859 WP_001181500.1.42861 WP_001181500.1.4289 WP_001181500.1.42892 WP_001181500.1.42923 WP_001181500.1.42932 WP_001181500.1.42957 WP_001181500.1.42978 WP_001181500.1.4298 WP_001181500.1.42981 WP_001181500.1.43008 WP_001181500.1.43016 WP_001181500.1.43019 WP_001181500.1.43065 WP_001181500.1.43068 WP_001181500.1.43069 WP_001181500.1.43077 WP_001181500.1.43089 WP_001181500.1.43128 WP_001181500.1.43141 WP_001181500.1.43149 WP_001181500.1.43157 WP_001181500.1.43161 WP_001181500.1.43190 WP_001181500.1.43198 WP_001181500.1.43201 WP_001181500.1.43258 WP_001181500.1.4326 WP_001181500.1.43272 WP_001181500.1.43276 WP_001181500.1.43290 WP_001181500.1.43292 WP_001181500.1.43299 WP_001181500.1.43307 WP_001181500.1.43339 WP_001181500.1.43351 WP_001181500.1.43371 WP_001181500.1.43438 WP_001181500.1.4344 WP_001181500.1.43441 WP_001181500.1.43508 WP_001181500.1.43513 WP_001181500.1.43520 WP_001181500.1.43606 WP_001181500.1.43633 WP_001181500.1.43637 WP_001181500.1.43651 WP_001181500.1.43654 WP_001181500.1.43676 WP_001181500.1.43685 WP_001181500.1.43710 WP_001181500.1.43711 WP_001181500.1.43722 WP_001181500.1.43763 WP_001181500.1.43778 WP_001181500.1.43782 WP_001181500.1.43785 WP_001181500.1.43801 WP_001181500.1.43812 WP_001181500.1.43828 WP_001181500.1.43839 WP_001181500.1.43864 WP_001181500.1.43878 WP_001181500.1.43888 WP_001181500.1.43919 WP_001181500.1.43951 WP_001181500.1.43974 WP_001181500.1.44010 WP_001181500.1.4404 WP_001181500.1.44049 WP_001181500.1.44063 WP_001181500.1.44101 WP_001181500.1.44160 WP_001181500.1.44180 WP_001181500.1.44191 WP_001181500.1.44196 WP_001181500.1.4422 WP_001181500.1.4423 WP_001181500.1.44248 WP_001181500.1.44250 WP_001181500.1.44262 WP_001181500.1.44268 WP_001181500.1.4427 WP_001181500.1.44296 WP_001181500.1.44300 WP_001181500.1.44337 WP_001181500.1.44339 WP_001181500.1.44343 WP_001181500.1.44351 WP_001181500.1.44359 WP_001181500.1.44360 WP_001181500.1.44380 WP_001181500.1.44397 WP_001181500.1.4440 WP_001181500.1.44416 WP_001181500.1.44431 WP_001181500.1.44433 WP_001181500.1.44437 WP_001181500.1.44443 WP_001181500.1.44453 WP_001181500.1.44474 WP_001181500.1.44546 WP_001181500.1.44633 WP_001181500.1.44636 WP_001181500.1.44678 WP_001181500.1.4468 WP_001181500.1.44705 WP_001181500.1.44762 WP_001181500.1.44791 WP_001181500.1.44815 WP_001181500.1.44828 WP_001181500.1.44831 WP_001181500.1.44833 WP_001181500.1.44879 WP_001181500.1.449 WP_001181500.1.44917 WP_001181500.1.44933 WP_001181500.1.44950 WP_001181500.1.44966 WP_001181500.1.44971 WP_001181500.1.44978 WP_001181500.1.44997 WP_001181500.1.44998 WP_001181500.1.4500 WP_001181500.1.4501 WP_001181500.1.45038 WP_001181500.1.45072 WP_001181500.1.45093 WP_001181500.1.45134 WP_001181500.1.45136 WP_001181500.1.45138 WP_001181500.1.45145 WP_001181500.1.45173 WP_001181500.1.45229 WP_001181500.1.45241 WP_001181500.1.45251 WP_001181500.1.45268 WP_001181500.1.45302 WP_001181500.1.4531 WP_001181500.1.45322 WP_001181500.1.45344 WP_001181500.1.45351 WP_001181500.1.4540 WP_001181500.1.45402 WP_001181500.1.45432 WP_001181500.1.45434 WP_001181500.1.45435 WP_001181500.1.45462 WP_001181500.1.45468 WP_001181500.1.45523 WP_001181500.1.45535 WP_001181500.1.45549 WP_001181500.1.45566 WP_001181500.1.45569 WP_001181500.1.45571 WP_001181500.1.45582 WP_001181500.1.45583 WP_001181500.1.45596 WP_001181500.1.45622 WP_001181500.1.45648 WP_001181500.1.45781 WP_001181500.1.45797 WP_001181500.1.45829 WP_001181500.1.45844 WP_001181500.1.45871 WP_001181500.1.45906 WP_001181500.1.45918 WP_001181500.1.4592 WP_001181500.1.45984 WP_001181500.1.46030 WP_001181500.1.46077 WP_001181500.1.46124 WP_001181500.1.46169 WP_001181500.1.46203 WP_001181500.1.46205 WP_001181500.1.46215 WP_001181500.1.46225 WP_001181500.1.46232 WP_001181500.1.46241 WP_001181500.1.46243 WP_001181500.1.46278 WP_001181500.1.46286 WP_001181500.1.46299 WP_001181500.1.46307 WP_001181500.1.46323 WP_001181500.1.46345 WP_001181500.1.46355 WP_001181500.1.46358 WP_001181500.1.464 WP_001181500.1.46406 WP_001181500.1.46434 WP_001181500.1.46444 WP_001181500.1.46454 WP_001181500.1.46461 WP_001181500.1.46504 WP_001181500.1.46505 WP_001181500.1.46551 WP_001181500.1.46559 WP_001181500.1.46572 WP_001181500.1.46574 WP_001181500.1.46578 WP_001181500.1.46637 WP_001181500.1.46666 WP_001181500.1.46689 WP_001181500.1.46701 WP_001181500.1.4671 WP_001181500.1.46726 WP_001181500.1.46732 WP_001181500.1.4674 WP_001181500.1.46781 WP_001181500.1.46803 WP_001181500.1.46816 WP_001181500.1.46842 WP_001181500.1.4686 WP_001181500.1.4690 WP_001181500.1.46920 WP_001181500.1.46945 WP_001181500.1.46967 WP_001181500.1.46976 WP_001181500.1.47005 WP_001181500.1.47008 WP_001181500.1.47014 WP_001181500.1.47036 WP_001181500.1.47037 WP_001181500.1.47042 WP_001181500.1.47058 WP_001181500.1.47059 WP_001181500.1.47085 WP_001181500.1.47123 WP_001181500.1.47215 WP_001181500.1.47245 WP_001181500.1.47389 WP_001181500.1.47442 WP_001181500.1.47460 WP_001181500.1.47482 WP_001181500.1.47492 WP_001181500.1.47506 WP_001181500.1.47507 WP_001181500.1.47523 WP_001181500.1.47531 WP_001181500.1.47532 WP_001181500.1.47567 WP_001181500.1.47576 WP_001181500.1.47579 WP_001181500.1.4758 WP_001181500.1.47587 WP_001181500.1.47605 WP_001181500.1.47614 WP_001181500.1.47630 WP_001181500.1.47649 WP_001181500.1.4769 WP_001181500.1.4770 WP_001181500.1.4774 WP_001181500.1.47756 WP_001181500.1.47767 WP_001181500.1.4781 WP_001181500.1.47814 WP_001181500.1.47817 WP_001181500.1.47829 WP_001181500.1.47849 WP_001181500.1.47850 WP_001181500.1.47875 WP_001181500.1.47886 WP_001181500.1.47898 WP_001181500.1.47902 WP_001181500.1.47911 WP_001181500.1.47928 WP_001181500.1.4795 WP_001181500.1.47988 WP_001181500.1.47992 WP_001181500.1.48019 WP_001181500.1.48100 WP_001181500.1.48114 WP_001181500.1.48124 WP_001181500.1.48132 WP_001181500.1.48139 WP_001181500.1.48190 WP_001181500.1.48209 WP_001181500.1.48218 WP_001181500.1.48244 WP_001181500.1.48247 WP_001181500.1.48262 WP_001181500.1.48268 WP_001181500.1.48292 WP_001181500.1.48324 WP_001181500.1.4839 WP_001181500.1.48399 WP_001181500.1.48426 WP_001181500.1.48430 WP_001181500.1.48436 WP_001181500.1.48524 WP_001181500.1.48570 WP_001181500.1.48586 WP_001181500.1.4859 WP_001181500.1.48591 WP_001181500.1.48610 WP_001181500.1.48631 WP_001181500.1.48647 WP_001181500.1.48651 WP_001181500.1.48663 WP_001181500.1.48690 WP_001181500.1.48734 WP_001181500.1.48751 WP_001181500.1.48755 WP_001181500.1.48756 WP_001181500.1.48774 WP_001181500.1.48778 WP_001181500.1.48797 WP_001181500.1.48849 WP_001181500.1.48855 WP_001181500.1.48896 WP_001181500.1.48908 WP_001181500.1.48918 WP_001181500.1.48931 WP_001181500.1.48955 WP_001181500.1.48963 WP_001181500.1.48973 WP_001181500.1.48985 WP_001181500.1.49004 WP_001181500.1.49005 WP_001181500.1.49012 WP_001181500.1.49090 WP_001181500.1.49106 WP_001181500.1.49113 WP_001181500.1.49117 WP_001181500.1.49121 WP_001181500.1.4914 WP_001181500.1.49140 WP_001181500.1.49153 WP_001181500.1.49162 WP_001181500.1.49166 WP_001181500.1.49214 WP_001181500.1.49262 WP_001181500.1.49311 WP_001181500.1.49334 WP_001181500.1.49355 WP_001181500.1.49358 WP_001181500.1.49429 WP_001181500.1.49434 WP_001181500.1.49450 WP_001181500.1.49472 WP_001181500.1.495 WP_001181500.1.49545 WP_001181500.1.49550 WP_001181500.1.49574 WP_001181500.1.49590 WP_001181500.1.49595 WP_001181500.1.49626 WP_001181500.1.49630 WP_001181500.1.49650 WP_001181500.1.49686 WP_001181500.1.49703 WP_001181500.1.49769 WP_001181500.1.49770 WP_001181500.1.49780 WP_001181500.1.49846 WP_001181500.1.49848 WP_001181500.1.4991 WP_001181500.1.49947 WP_001181500.1.49959 WP_001181500.1.49997 WP_001181500.1.50 WP_001181500.1.50003 WP_001181500.1.50014 WP_001181500.1.50030 WP_001181500.1.50043 WP_001181500.1.50103 WP_001181500.1.50128 WP_001181500.1.50158 WP_001181500.1.50198 WP_001181500.1.50238 WP_001181500.1.50247 WP_001181500.1.50251 WP_001181500.1.50285 WP_001181500.1.50308 WP_001181500.1.50309 WP_001181500.1.50332 WP_001181500.1.50349 WP_001181500.1.50386 WP_001181500.1.50387 WP_001181500.1.50404 WP_001181500.1.50406 WP_001181500.1.50413 WP_001181500.1.50449 WP_001181500.1.50468 WP_001181500.1.50480 WP_001181500.1.5051 WP_001181500.1.50517 WP_001181500.1.50565 WP_001181500.1.50566 WP_001181500.1.50570 WP_001181500.1.5058 WP_001181500.1.50593 WP_001181500.1.50626 WP_001181500.1.50652 WP_001181500.1.50684 WP_001181500.1.50726 WP_001181500.1.50769 WP_001181500.1.50771 WP_001181500.1.50774 WP_001181500.1.50811 WP_001181500.1.50875 WP_001181500.1.50882 WP_001181500.1.50885 WP_001181500.1.50893 WP_001181500.1.509 WP_001181500.1.50905 WP_001181500.1.50918 WP_001181500.1.50929 WP_001181500.1.50954 WP_001181500.1.50960 WP_001181500.1.50970 WP_001181500.1.50999 WP_001181500.1.51036 WP_001181500.1.51040 WP_001181500.1.51048 WP_001181500.1.51066 WP_001181500.1.51100 WP_001181500.1.51131 WP_001181500.1.51134 WP_001181500.1.5114 WP_001181500.1.51178 WP_001181500.1.51224 WP_001181500.1.51227 WP_001181500.1.5125 WP_001181500.1.5127 WP_001181500.1.51285 WP_001181500.1.51305 WP_001181500.1.51308 WP_001181500.1.51315 WP_001181500.1.51331 WP_001181500.1.51338 WP_001181500.1.51356 WP_001181500.1.5136 WP_001181500.1.5138 WP_001181500.1.51394 WP_001181500.1.51412 WP_001181500.1.51451 WP_001181500.1.51474 WP_001181500.1.51502 WP_001181500.1.51514 WP_001181500.1.51518 WP_001181500.1.51519 WP_001181500.1.51598 WP_001181500.1.51613 WP_001181500.1.51642 WP_001181500.1.51644 WP_001181500.1.51704 WP_001181500.1.51724 WP_001181500.1.51734 WP_001181500.1.51764 WP_001181500.1.51810 WP_001181500.1.51831 WP_001181500.1.51838 WP_001181500.1.51863 WP_001181500.1.51868 WP_001181500.1.51900 WP_001181500.1.51910 WP_001181500.1.51914 WP_001181500.1.51930 WP_001181500.1.51935 WP_001181500.1.51994 WP_001181500.1.520 WP_001181500.1.52057 WP_001181500.1.5211 WP_001181500.1.52114 WP_001181500.1.52123 WP_001181500.1.52129 WP_001181500.1.52148 WP_001181500.1.52156 WP_001181500.1.52161 WP_001181500.1.52170 WP_001181500.1.52191 WP_001181500.1.52202 WP_001181500.1.52209 WP_001181500.1.52301 WP_001181500.1.52321 WP_001181500.1.52336 WP_001181500.1.52339 WP_001181500.1.52356 WP_001181500.1.52438 WP_001181500.1.52446 WP_001181500.1.52456 WP_001181500.1.52469 WP_001181500.1.52527 WP_001181500.1.52528 WP_001181500.1.52571 WP_001181500.1.52582 WP_001181500.1.52586 WP_001181500.1.526 WP_001181500.1.52608 WP_001181500.1.52637 WP_001181500.1.52647 WP_001181500.1.52675 WP_001181500.1.52692 WP_001181500.1.5273 WP_001181500.1.52738 WP_001181500.1.52742 WP_001181500.1.52744 WP_001181500.1.52748 WP_001181500.1.52773 WP_001181500.1.52795 WP_001181500.1.52807 WP_001181500.1.52824 WP_001181500.1.52833 WP_001181500.1.52851 WP_001181500.1.52858 WP_001181500.1.52866 WP_001181500.1.52887 WP_001181500.1.52949 WP_001181500.1.5301 WP_001181500.1.53092 WP_001181500.1.53100 WP_001181500.1.53107 WP_001181500.1.53119 WP_001181500.1.5313 WP_001181500.1.53141 WP_001181500.1.53151 WP_001181500.1.53154 WP_001181500.1.53158 WP_001181500.1.53159 WP_001181500.1.5316 WP_001181500.1.53179 WP_001181500.1.53203 WP_001181500.1.53210 WP_001181500.1.53233 WP_001181500.1.53234 WP_001181500.1.53272 WP_001181500.1.53274 WP_001181500.1.53315 WP_001181500.1.53321 WP_001181500.1.5333 WP_001181500.1.53362 WP_001181500.1.53368 WP_001181500.1.53375 WP_001181500.1.53385 WP_001181500.1.53436 WP_001181500.1.53450 WP_001181500.1.5349 WP_001181500.1.53534 WP_001181500.1.53540 WP_001181500.1.53555 WP_001181500.1.53559 WP_001181500.1.5356 WP_001181500.1.53567 WP_001181500.1.53571 WP_001181500.1.5358 WP_001181500.1.53664 WP_001181500.1.53692 WP_001181500.1.53696 WP_001181500.1.53723 WP_001181500.1.5374 WP_001181500.1.53750 WP_001181500.1.53772 WP_001181500.1.53778 WP_001181500.1.53781 WP_001181500.1.53790 WP_001181500.1.53800 WP_001181500.1.53814 WP_001181500.1.53815 WP_001181500.1.53839 WP_001181500.1.53892 WP_001181500.1.53896 WP_001181500.1.53898 WP_001181500.1.53902 WP_001181500.1.53905 WP_001181500.1.5392 WP_001181500.1.53935 WP_001181500.1.53958 WP_001181500.1.53961 WP_001181500.1.53981 WP_001181500.1.53984 WP_001181500.1.54068 WP_001181500.1.54085 WP_001181500.1.54132 WP_001181500.1.5415 WP_001181500.1.54170 WP_001181500.1.54175 WP_001181500.1.542 WP_001181500.1.54203 WP_001181500.1.54259 WP_001181500.1.54273 WP_001181500.1.54283 WP_001181500.1.5430 WP_001181500.1.54324 WP_001181500.1.54333 WP_001181500.1.54366 WP_001181500.1.54371 WP_001181500.1.54431 WP_001181500.1.54442 WP_001181500.1.54469 WP_001181500.1.54482 WP_001181500.1.54522 WP_001181500.1.54526 WP_001181500.1.54558 WP_001181500.1.5456 WP_001181500.1.54569 WP_001181500.1.54589 WP_001181500.1.5459 WP_001181500.1.54607 WP_001181500.1.54615 WP_001181500.1.54667 WP_001181500.1.54678 WP_001181500.1.54681 WP_001181500.1.54694 WP_001181500.1.54748 WP_001181500.1.54774 WP_001181500.1.5481 WP_001181500.1.54814 WP_001181500.1.54822 WP_001181500.1.54827 WP_001181500.1.54833 WP_001181500.1.54845 WP_001181500.1.5485 WP_001181500.1.54865 WP_001181500.1.54877 WP_001181500.1.5493 WP_001181500.1.54935 WP_001181500.1.54936 WP_001181500.1.54979 WP_001181500.1.54984 WP_001181500.1.54992 WP_001181500.1.55010 WP_001181500.1.55034 WP_001181500.1.55073 WP_001181500.1.55163 WP_001181500.1.55165 WP_001181500.1.55166 WP_001181500.1.55215 WP_001181500.1.5525 WP_001181500.1.55290 WP_001181500.1.55294 WP_001181500.1.55310 WP_001181500.1.55317 WP_001181500.1.55325 WP_001181500.1.55361 WP_001181500.1.55379 WP_001181500.1.5539 WP_001181500.1.55430 WP_001181500.1.55461 WP_001181500.1.55468 WP_001181500.1.55477 WP_001181500.1.55496 WP_001181500.1.55506 WP_001181500.1.5552 WP_001181500.1.55528 WP_001181500.1.55545 WP_001181500.1.55554 WP_001181500.1.55557 WP_001181500.1.55559 WP_001181500.1.5560 WP_001181500.1.55604 WP_001181500.1.55614 WP_001181500.1.55623 WP_001181500.1.55639 WP_001181500.1.55640 WP_001181500.1.55672 WP_001181500.1.55699 WP_001181500.1.55718 WP_001181500.1.5572 WP_001181500.1.55725 WP_001181500.1.5577 WP_001181500.1.55780 WP_001181500.1.55803 WP_001181500.1.55853 WP_001181500.1.55923 WP_001181500.1.55948 WP_001181500.1.55967 WP_001181500.1.55973 WP_001181500.1.55993 WP_001181500.1.55995 WP_001181500.1.56026 WP_001181500.1.56069 WP_001181500.1.56082 WP_001181500.1.56097 WP_001181500.1.56144 WP_001181500.1.56152 WP_001181500.1.56172 WP_001181500.1.5621 WP_001181500.1.56222 WP_001181500.1.56226 WP_001181500.1.56235 WP_001181500.1.56244 WP_001181500.1.56261 WP_001181500.1.56263 WP_001181500.1.56303 WP_001181500.1.56311 WP_001181500.1.5633 WP_001181500.1.56354 WP_001181500.1.56368 WP_001181500.1.56370 WP_001181500.1.56389 WP_001181500.1.56396 WP_001181500.1.56413 WP_001181500.1.56419 WP_001181500.1.56420 WP_001181500.1.56423 WP_001181500.1.56468 WP_001181500.1.56514 WP_001181500.1.56535 WP_001181500.1.56559 WP_001181500.1.56585 WP_001181500.1.56615 WP_001181500.1.56640 WP_001181500.1.56647 WP_001181500.1.56651 WP_001181500.1.56660 WP_001181500.1.5668 WP_001181500.1.56724 WP_001181500.1.56824 WP_001181500.1.56825 WP_001181500.1.56851 WP_001181500.1.56853 WP_001181500.1.56861 WP_001181500.1.56887 WP_001181500.1.56889 WP_001181500.1.56893 WP_001181500.1.56898 WP_001181500.1.56905 WP_001181500.1.56950 WP_001181500.1.56981 WP_001181500.1.57000 WP_001181500.1.57026 WP_001181500.1.57039 WP_001181500.1.57056 WP_001181500.1.57076 WP_001181500.1.57101 WP_001181500.1.5711 WP_001181500.1.57137 WP_001181500.1.57143 WP_001181500.1.57147 WP_001181500.1.57179 WP_001181500.1.57186 WP_001181500.1.57232 WP_001181500.1.57233 WP_001181500.1.57246 WP_001181500.1.57296 WP_001181500.1.57307 WP_001181500.1.57342 WP_001181500.1.57344 WP_001181500.1.57356 WP_001181500.1.57362 WP_001181500.1.57399 WP_001181500.1.57494 WP_001181500.1.57495 WP_001181500.1.57510 WP_001181500.1.57555 WP_001181500.1.57559 WP_001181500.1.57631 WP_001181500.1.57684 WP_001181500.1.57699 WP_001181500.1.57709 WP_001181500.1.57710 WP_001181500.1.5774 WP_001181500.1.57781 WP_001181500.1.57785 WP_001181500.1.57797 WP_001181500.1.57800 WP_001181500.1.5781 WP_001181500.1.57857 WP_001181500.1.57873 WP_001181500.1.57893 WP_001181500.1.57965 WP_001181500.1.57972 WP_001181500.1.58008 WP_001181500.1.58040 WP_001181500.1.58044 WP_001181500.1.58081 WP_001181500.1.5809 WP_001181500.1.58090 WP_001181500.1.58131 WP_001181500.1.58132 WP_001181500.1.58153 WP_001181500.1.58157 WP_001181500.1.58173 WP_001181500.1.58191 WP_001181500.1.58194 WP_001181500.1.58239 WP_001181500.1.58252 WP_001181500.1.58261 WP_001181500.1.58274 WP_001181500.1.5828 WP_001181500.1.58282 WP_001181500.1.58290 WP_001181500.1.58324 WP_001181500.1.58326 WP_001181500.1.58334 WP_001181500.1.58357 WP_001181500.1.58358 WP_001181500.1.5836 WP_001181500.1.58372 WP_001181500.1.58407 WP_001181500.1.58416 WP_001181500.1.58443 WP_001181500.1.58451 WP_001181500.1.5846 WP_001181500.1.58485 WP_001181500.1.58486 WP_001181500.1.58489 WP_001181500.1.58537 WP_001181500.1.5854 WP_001181500.1.58568 WP_001181500.1.58583 WP_001181500.1.58604 WP_001181500.1.58652 WP_001181500.1.58663 WP_001181500.1.58675 WP_001181500.1.587 WP_001181500.1.58724 WP_001181500.1.58729 WP_001181500.1.58744 WP_001181500.1.58749 WP_001181500.1.5875 WP_001181500.1.58796 WP_001181500.1.58807 WP_001181500.1.58834 WP_001181500.1.58847 WP_001181500.1.58861 WP_001181500.1.58883 WP_001181500.1.58884 WP_001181500.1.58898 WP_001181500.1.58926 WP_001181500.1.58949 WP_001181500.1.58963 WP_001181500.1.58970 WP_001181500.1.58974 WP_001181500.1.59006 WP_001181500.1.59012 WP_001181500.1.59020 WP_001181500.1.59043 WP_001181500.1.59056 WP_001181500.1.59061 WP_001181500.1.59064 WP_001181500.1.59097 WP_001181500.1.59136 WP_001181500.1.59142 WP_001181500.1.59148 WP_001181500.1.59163 WP_001181500.1.59236 WP_001181500.1.59282 WP_001181500.1.5929 WP_001181500.1.59294 WP_001181500.1.59299 WP_001181500.1.59313 WP_001181500.1.59335 WP_001181500.1.59336 WP_001181500.1.59381 WP_001181500.1.59412 WP_001181500.1.59420 WP_001181500.1.59427 WP_001181500.1.59439 WP_001181500.1.59486 WP_001181500.1.5949 WP_001181500.1.59501 WP_001181500.1.59510 WP_001181500.1.59512 WP_001181500.1.59521 WP_001181500.1.5953 WP_001181500.1.59538 WP_001181500.1.59548 WP_001181500.1.59562 WP_001181500.1.59587 WP_001181500.1.59604 WP_001181500.1.59636 WP_001181500.1.59641 WP_001181500.1.59646 WP_001181500.1.5969 WP_001181500.1.59710 WP_001181500.1.59751 WP_001181500.1.59755 WP_001181500.1.59827 WP_001181500.1.59829 WP_001181500.1.59830 WP_001181500.1.59847 WP_001181500.1.59848 WP_001181500.1.59863 WP_001181500.1.59969 WP_001181500.1.59979 WP_001181500.1.59994 WP_001181500.1.60015 WP_001181500.1.60045 WP_001181500.1.60052 WP_001181500.1.60076 WP_001181500.1.60114 WP_001181500.1.60126 WP_001181500.1.60137 WP_001181500.1.60154 WP_001181500.1.60168 WP_001181500.1.60192 WP_001181500.1.60199 WP_001181500.1.60209 WP_001181500.1.60212 WP_001181500.1.60213 WP_001181500.1.60226 WP_001181500.1.60231 WP_001181500.1.60253 WP_001181500.1.60320 WP_001181500.1.60322 WP_001181500.1.60324 WP_001181500.1.6033 WP_001181500.1.60330 WP_001181500.1.60356 WP_001181500.1.60370 WP_001181500.1.6038 WP_001181500.1.60380 WP_001181500.1.6041 WP_001181500.1.60424 WP_001181500.1.60425 WP_001181500.1.60481 WP_001181500.1.605 WP_001181500.1.60503 WP_001181500.1.6052 WP_001181500.1.60545 WP_001181500.1.60560 WP_001181500.1.60561 WP_001181500.1.6058 WP_001181500.1.60584 WP_001181500.1.60597 WP_001181500.1.6060 WP_001181500.1.60608 WP_001181500.1.60622 WP_001181500.1.60676 WP_001181500.1.60708 WP_001181500.1.60713 WP_001181500.1.60725 WP_001181500.1.60760 WP_001181500.1.60772 WP_001181500.1.60783 WP_001181500.1.60792 WP_001181500.1.608 WP_001181500.1.60807 WP_001181500.1.6086 WP_001181500.1.60863 WP_001181500.1.60866 WP_001181500.1.60882 WP_001181500.1.60889 WP_001181500.1.60897 WP_001181500.1.6090 WP_001181500.1.60919 WP_001181500.1.60926 WP_001181500.1.60950 WP_001181500.1.60976 WP_001181500.1.60988 WP_001181500.1.60990 WP_001181500.1.6104 WP_001181500.1.61044 WP_001181500.1.61045 WP_001181500.1.61076 WP_001181500.1.6108 WP_001181500.1.61087 WP_001181500.1.61123 WP_001181500.1.61147 WP_001181500.1.61168 WP_001181500.1.61184 WP_001181500.1.61200 WP_001181500.1.61210 WP_001181500.1.61218 WP_001181500.1.61356 WP_001181500.1.61357 WP_001181500.1.61381 WP_001181500.1.61434 WP_001181500.1.61497 WP_001181500.1.61501 WP_001181500.1.61509 WP_001181500.1.61511 WP_001181500.1.61519 WP_001181500.1.61539 WP_001181500.1.61542 WP_001181500.1.61553 WP_001181500.1.61582 WP_001181500.1.61594 WP_001181500.1.61595 WP_001181500.1.61609 WP_001181500.1.6164 WP_001181500.1.61649 WP_001181500.1.61652 WP_001181500.1.61662 WP_001181500.1.61667 WP_001181500.1.61671 WP_001181500.1.61697 WP_001181500.1.61732 WP_001181500.1.61737 WP_001181500.1.61743 WP_001181500.1.61783 WP_001181500.1.61809 WP_001181500.1.61877 WP_001181500.1.61908 WP_001181500.1.61920 WP_001181500.1.61922 WP_001181500.1.61968 WP_001181500.1.62020 WP_001181500.1.6209 WP_001181500.1.62120 WP_001181500.1.62122 WP_001181500.1.62124 WP_001181500.1.62142 WP_001181500.1.62144 WP_001181500.1.62158 WP_001181500.1.62199 WP_001181500.1.62201 WP_001181500.1.62210 WP_001181500.1.62222 WP_001181500.1.62223 WP_001181500.1.62241 WP_001181500.1.62245 WP_001181500.1.62257 WP_001181500.1.62271 WP_001181500.1.62302 WP_001181500.1.62314 WP_001181500.1.62323 WP_001181500.1.62333 WP_001181500.1.62338 WP_001181500.1.62339 WP_001181500.1.62344 WP_001181500.1.62361 WP_001181500.1.62380 WP_001181500.1.62411 WP_001181500.1.62412 WP_001181500.1.62436 WP_001181500.1.62442 WP_001181500.1.62475 WP_001181500.1.62522 WP_001181500.1.62536 WP_001181500.1.62564 WP_001181500.1.62570 WP_001181500.1.62640 WP_001181500.1.62648 WP_001181500.1.62677 WP_001181500.1.62686 WP_001181500.1.62693 WP_001181500.1.627 WP_001181500.1.62725 WP_001181500.1.62745 WP_001181500.1.62751 WP_001181500.1.62757 WP_001181500.1.62798 WP_001181500.1.62825 WP_001181500.1.62913 WP_001181500.1.6292 WP_001181500.1.62932 WP_001181500.1.62960 WP_001181500.1.62976 WP_001181500.1.62983 WP_001181500.1.62988 WP_001181500.1.63016 WP_001181500.1.63025 WP_001181500.1.63045 WP_001181500.1.63063 WP_001181500.1.63069 WP_001181500.1.63087 WP_001181500.1.63102 WP_001181500.1.63118 WP_001181500.1.63129 WP_001181500.1.63135 WP_001181500.1.63155 WP_001181500.1.63169 WP_001181500.1.63186 WP_001181500.1.63229 WP_001181500.1.63243 WP_001181500.1.63297 WP_001181500.1.63358 WP_001181500.1.63448 WP_001181500.1.63455 WP_001181500.1.63497 WP_001181500.1.63499 WP_001181500.1.63509 WP_001181500.1.63513 WP_001181500.1.63514 WP_001181500.1.63525 WP_001181500.1.63529 WP_001181500.1.63532 WP_001181500.1.6357 WP_001181500.1.63583 WP_001181500.1.63585 WP_001181500.1.63592 WP_001181500.1.63603 WP_001181500.1.63633 WP_001181500.1.63663 WP_001181500.1.63690 WP_001181500.1.6370 WP_001181500.1.63731 WP_001181500.1.63736 WP_001181500.1.63748 WP_001181500.1.63781 WP_001181500.1.63782 WP_001181500.1.63797 WP_001181500.1.63816 WP_001181500.1.63831 WP_001181500.1.63851 WP_001181500.1.63860 WP_001181500.1.63863 WP_001181500.1.63864 WP_001181500.1.63866 WP_001181500.1.63876 WP_001181500.1.6389 WP_001181500.1.63901 WP_001181500.1.63912 WP_001181500.1.63934 WP_001181500.1.63955 WP_001181500.1.63958 WP_001181500.1.63963 WP_001181500.1.6399 WP_001181500.1.64010 WP_001181500.1.64018 WP_001181500.1.64032 WP_001181500.1.64034 WP_001181500.1.64072 WP_001181500.1.64085 WP_001181500.1.64087 WP_001181500.1.64121 WP_001181500.1.6415 WP_001181500.1.64157 WP_001181500.1.64208 WP_001181500.1.64229 WP_001181500.1.64293 WP_001181500.1.64294 WP_001181500.1.64332 WP_001181500.1.64350 WP_001181500.1.6437 WP_001181500.1.64374 WP_001181500.1.64376 WP_001181500.1.64385 WP_001181500.1.64387 WP_001181500.1.644 WP_001181500.1.64462 WP_001181500.1.64471 WP_001181500.1.64500 WP_001181500.1.64501 WP_001181500.1.6451 WP_001181500.1.64538 WP_001181500.1.64597 WP_001181500.1.64632 WP_001181500.1.64645 WP_001181500.1.64648 WP_001181500.1.64654 WP_001181500.1.64662 WP_001181500.1.64690 WP_001181500.1.64709 WP_001181500.1.64710 WP_001181500.1.64711 WP_001181500.1.64744 WP_001181500.1.64763 WP_001181500.1.64771 WP_001181500.1.64798 WP_001181500.1.64817 WP_001181500.1.64847 WP_001181500.1.6487 WP_001181500.1.64891 WP_001181500.1.64894 WP_001181500.1.64944 WP_001181500.1.64972 WP_001181500.1.64974 WP_001181500.1.64977 WP_001181500.1.65011 WP_001181500.1.65022 WP_001181500.1.65054 WP_001181500.1.65075 WP_001181500.1.6514 WP_001181500.1.65168 WP_001181500.1.65172 WP_001181500.1.65185 WP_001181500.1.65191 WP_001181500.1.65200 WP_001181500.1.65211 WP_001181500.1.65218 WP_001181500.1.65226 WP_001181500.1.65238 WP_001181500.1.65249 WP_001181500.1.6525 WP_001181500.1.65266 WP_001181500.1.65269 WP_001181500.1.65348 WP_001181500.1.65357 WP_001181500.1.65363 WP_001181500.1.65395 WP_001181500.1.65437 WP_001181500.1.65459 WP_001181500.1.65463 WP_001181500.1.65487 WP_001181500.1.6549 WP_001181500.1.65499 WP_001181500.1.6550 WP_001181500.1.65508 WP_001181500.1.6554 WP_001181500.1.65558 WP_001181500.1.65572 WP_001181500.1.6560 WP_001181500.1.65601 WP_001181500.1.6561 WP_001181500.1.65650 WP_001181500.1.65697 WP_001181500.1.65698 WP_001181500.1.65699 WP_001181500.1.6572 WP_001181500.1.65737 WP_001181500.1.65755 WP_001181500.1.65771 WP_001181500.1.65795 WP_001181500.1.65812 WP_001181500.1.65846 WP_001181500.1.65849 WP_001181500.1.65863 WP_001181500.1.65876 WP_001181500.1.65881 WP_001181500.1.65883 WP_001181500.1.65901 WP_001181500.1.65940 WP_001181500.1.6595 WP_001181500.1.65956 WP_001181500.1.65968 WP_001181500.1.65985 WP_001181500.1.66021 WP_001181500.1.66031 WP_001181500.1.66049 WP_001181500.1.66052 WP_001181500.1.66064 WP_001181500.1.66074 WP_001181500.1.66082 WP_001181500.1.66085 WP_001181500.1.66109 WP_001181500.1.66122 WP_001181500.1.66129 WP_001181500.1.66145 WP_001181500.1.66171 WP_001181500.1.66183 WP_001181500.1.6620 WP_001181500.1.66216 WP_001181500.1.66234 WP_001181500.1.66235 WP_001181500.1.66273 WP_001181500.1.66289 WP_001181500.1.66315 WP_001181500.1.66324 WP_001181500.1.66330 WP_001181500.1.6634 WP_001181500.1.66361 WP_001181500.1.66365 WP_001181500.1.66368 WP_001181500.1.66385 WP_001181500.1.66400 WP_001181500.1.66428 WP_001181500.1.66446 WP_001181500.1.66462 WP_001181500.1.6647 WP_001181500.1.66480 WP_001181500.1.66492 WP_001181500.1.66506 WP_001181500.1.66539 WP_001181500.1.66600 WP_001181500.1.66665 WP_001181500.1.66678 WP_001181500.1.66681 WP_001181500.1.66684 WP_001181500.1.66733 WP_001181500.1.66755 WP_001181500.1.66759 WP_001181500.1.66779 WP_001181500.1.66800 WP_001181500.1.66801 WP_001181500.1.66825 WP_001181500.1.66860 WP_001181500.1.66876 WP_001181500.1.66937 WP_001181500.1.66953 WP_001181500.1.66955 WP_001181500.1.66959 WP_001181500.1.66981 WP_001181500.1.67 WP_001181500.1.67024 WP_001181500.1.67042 WP_001181500.1.67075 WP_001181500.1.6710 WP_001181500.1.67100 WP_001181500.1.67101 WP_001181500.1.67143 WP_001181500.1.67173 WP_001181500.1.67201 WP_001181500.1.67211 WP_001181500.1.67235 WP_001181500.1.67237 WP_001181500.1.67279 WP_001181500.1.67288 WP_001181500.1.67336 WP_001181500.1.67339 WP_001181500.1.67387 WP_001181500.1.6739 WP_001181500.1.67394 WP_001181500.1.67397 WP_001181500.1.67403 WP_001181500.1.67424 WP_001181500.1.67430 WP_001181500.1.67442 WP_001181500.1.67539 WP_001181500.1.67556 WP_001181500.1.67576 WP_001181500.1.6760 WP_001181500.1.67603 WP_001181500.1.67604 WP_001181500.1.67617 WP_001181500.1.67619 WP_001181500.1.67625 WP_001181500.1.67627 WP_001181500.1.67633 WP_001181500.1.67641 WP_001181500.1.67657 WP_001181500.1.67673 WP_001181500.1.67700 WP_001181500.1.67718 WP_001181500.1.67729 WP_001181500.1.67731 WP_001181500.1.67772 WP_001181500.1.67774 WP_001181500.1.67776 WP_001181500.1.67803 WP_001181500.1.67814 WP_001181500.1.6782 WP_001181500.1.67820 WP_001181500.1.67827 WP_001181500.1.6785 WP_001181500.1.67910 WP_001181500.1.67924 WP_001181500.1.67932 WP_001181500.1.67954 WP_001181500.1.67969 WP_001181500.1.67970 WP_001181500.1.67977 WP_001181500.1.68 WP_001181500.1.68036 WP_001181500.1.68043 WP_001181500.1.68075 WP_001181500.1.6809 WP_001181500.1.68105 WP_001181500.1.68113 WP_001181500.1.68115 WP_001181500.1.68131 WP_001181500.1.68140 WP_001181500.1.68147 WP_001181500.1.68159 WP_001181500.1.68167 WP_001181500.1.68182 WP_001181500.1.6819 WP_001181500.1.68210 WP_001181500.1.68285 WP_001181500.1.68359 WP_001181500.1.68420 WP_001181500.1.68477 WP_001181500.1.685 WP_001181500.1.68514 WP_001181500.1.68532 WP_001181500.1.68564 WP_001181500.1.6857 WP_001181500.1.6858 WP_001181500.1.68629 WP_001181500.1.68652 WP_001181500.1.68658 WP_001181500.1.68677 WP_001181500.1.68688 WP_001181500.1.68690 WP_001181500.1.68742 WP_001181500.1.68770 WP_001181500.1.6879 WP_001181500.1.68809 WP_001181500.1.68816 WP_001181500.1.6882 WP_001181500.1.68893 WP_001181500.1.68895 WP_001181500.1.68914 WP_001181500.1.68958 WP_001181500.1.68966 WP_001181500.1.68999 WP_001181500.1.69001 WP_001181500.1.69011 WP_001181500.1.69029 WP_001181500.1.6904 WP_001181500.1.69053 WP_001181500.1.69058 WP_001181500.1.6907 WP_001181500.1.69080 WP_001181500.1.69086 WP_001181500.1.69131 WP_001181500.1.69151 WP_001181500.1.69170 WP_001181500.1.69210 WP_001181500.1.69236 WP_001181500.1.69270 WP_001181500.1.69273 WP_001181500.1.69282 WP_001181500.1.69296 WP_001181500.1.69320 WP_001181500.1.69346 WP_001181500.1.69357 WP_001181500.1.69359 WP_001181500.1.69376 WP_001181500.1.69385 WP_001181500.1.69396 WP_001181500.1.69466 WP_001181500.1.69485 WP_001181500.1.69515 WP_001181500.1.6954 WP_001181500.1.69554 WP_001181500.1.69575 WP_001181500.1.69588 WP_001181500.1.69597 WP_001181500.1.69611 WP_001181500.1.69616 WP_001181500.1.69636 WP_001181500.1.69642 WP_001181500.1.69656 WP_001181500.1.69657 WP_001181500.1.69690 WP_001181500.1.69710 WP_001181500.1.69754 WP_001181500.1.69758 WP_001181500.1.69760 WP_001181500.1.69767 WP_001181500.1.69785 WP_001181500.1.69787 WP_001181500.1.69807 WP_001181500.1.69808 WP_001181500.1.69817 WP_001181500.1.69848 WP_001181500.1.69923 WP_001181500.1.69948 WP_001181500.1.69953 WP_001181500.1.69965 WP_001181500.1.69975 WP_001181500.1.69977 WP_001181500.1.70003 WP_001181500.1.70010 WP_001181500.1.70028 WP_001181500.1.70047 WP_001181500.1.70049 WP_001181500.1.70058 WP_001181500.1.70061 WP_001181500.1.70088 WP_001181500.1.70169 WP_001181500.1.70183 WP_001181500.1.70205 WP_001181500.1.70240 WP_001181500.1.70249 WP_001181500.1.70261 WP_001181500.1.70272 WP_001181500.1.70281 WP_001181500.1.70290 WP_001181500.1.70303 WP_001181500.1.70314 WP_001181500.1.70321 WP_001181500.1.70327 WP_001181500.1.7033 WP_001181500.1.70355 WP_001181500.1.70427 WP_001181500.1.70433 WP_001181500.1.7044 WP_001181500.1.70440 WP_001181500.1.70491 WP_001181500.1.70531 WP_001181500.1.70545 WP_001181500.1.7055 WP_001181500.1.70596 WP_001181500.1.70623 WP_001181500.1.70644 WP_001181500.1.70671 WP_001181500.1.70678 WP_001181500.1.70679 WP_001181500.1.70685 WP_001181500.1.70708 WP_001181500.1.70712 WP_001181500.1.70717 WP_001181500.1.70732 WP_001181500.1.70733 WP_001181500.1.70761 WP_001181500.1.70772 WP_001181500.1.70785 WP_001181500.1.70837 WP_001181500.1.70845 WP_001181500.1.70846 WP_001181500.1.70869 WP_001181500.1.70899 WP_001181500.1.70929 WP_001181500.1.7093 WP_001181500.1.70959 WP_001181500.1.70971 WP_001181500.1.70977 WP_001181500.1.70981 WP_001181500.1.70986 WP_001181500.1.70995 WP_001181500.1.71007 WP_001181500.1.71010 WP_001181500.1.71023 WP_001181500.1.71039 WP_001181500.1.71057 WP_001181500.1.71069 WP_001181500.1.71081 WP_001181500.1.71117 WP_001181500.1.71120 WP_001181500.1.71172 WP_001181500.1.71184 WP_001181500.1.71186 WP_001181500.1.71201 WP_001181500.1.71305 WP_001181500.1.71363 WP_001181500.1.714 WP_001181500.1.7142 WP_001181500.1.71446 WP_001181500.1.71450 WP_001181500.1.71452 WP_001181500.1.71455 WP_001181500.1.71456 WP_001181500.1.71481 WP_001181500.1.71487 WP_001181500.1.71523 WP_001181500.1.71542 WP_001181500.1.71566 WP_001181500.1.71583 WP_001181500.1.71600 WP_001181500.1.71626 WP_001181500.1.71636 WP_001181500.1.71640 WP_001181500.1.71649 WP_001181500.1.71651 WP_001181500.1.71653 WP_001181500.1.71691 WP_001181500.1.71716 WP_001181500.1.7174 WP_001181500.1.71746 WP_001181500.1.71756 WP_001181500.1.71798 WP_001181500.1.71872 WP_001181500.1.71923 WP_001181500.1.71929 WP_001181500.1.71941 WP_001181500.1.71950 WP_001181500.1.71954 WP_001181500.1.71979 WP_001181500.1.71984 WP_001181500.1.71985 WP_001181500.1.720 WP_001181500.1.72003 WP_001181500.1.72068 WP_001181500.1.72073 WP_001181500.1.72100 WP_001181500.1.72107 WP_001181500.1.72119 WP_001181500.1.72182 WP_001181500.1.72190 WP_001181500.1.72220 WP_001181500.1.72221 WP_001181500.1.72226 WP_001181500.1.72234 WP_001181500.1.72243 WP_001181500.1.72269 WP_001181500.1.72283 WP_001181500.1.72300 WP_001181500.1.72307 WP_001181500.1.72325 WP_001181500.1.72339 WP_001181500.1.72350 WP_001181500.1.72351 WP_001181500.1.72372 WP_001181500.1.72382 WP_001181500.1.72383 WP_001181500.1.72403 WP_001181500.1.72412 WP_001181500.1.7243 WP_001181500.1.72438 WP_001181500.1.72461 WP_001181500.1.72470 WP_001181500.1.72527 WP_001181500.1.72532 WP_001181500.1.7255 WP_001181500.1.72602 WP_001181500.1.72625 WP_001181500.1.72629 WP_001181500.1.72631 WP_001181500.1.72638 WP_001181500.1.72642 WP_001181500.1.72667 WP_001181500.1.72671 WP_001181500.1.72674 WP_001181500.1.72716 WP_001181500.1.72718 WP_001181500.1.72724 WP_001181500.1.72728 WP_001181500.1.72789 WP_001181500.1.72793 WP_001181500.1.72827 WP_001181500.1.72828 WP_001181500.1.72865 WP_001181500.1.72872 WP_001181500.1.72887 WP_001181500.1.72896 WP_001181500.1.72897 WP_001181500.1.72944 WP_001181500.1.7295 WP_001181500.1.72968 WP_001181500.1.72969 WP_001181500.1.72987 WP_001181500.1.7304 WP_001181500.1.73052 WP_001181500.1.73062 WP_001181500.1.73068 WP_001181500.1.7311 WP_001181500.1.73114 WP_001181500.1.73125 WP_001181500.1.7316 WP_001181500.1.73177 WP_001181500.1.73180 WP_001181500.1.73258 WP_001181500.1.73285 WP_001181500.1.7332 WP_001181500.1.73328 WP_001181500.1.7333 WP_001181500.1.73352 WP_001181500.1.73362 WP_001181500.1.73379 WP_001181500.1.73389 WP_001181500.1.7341 WP_001181500.1.73425 WP_001181500.1.73488 WP_001181500.1.73504 WP_001181500.1.7353 WP_001181500.1.73544 WP_001181500.1.73561 WP_001181500.1.73596 WP_001181500.1.73598 WP_001181500.1.7361 WP_001181500.1.73648 WP_001181500.1.73667 WP_001181500.1.73701 WP_001181500.1.73708 WP_001181500.1.7374 WP_001181500.1.73764 WP_001181500.1.73768 WP_001181500.1.73804 WP_001181500.1.73831 WP_001181500.1.73847 WP_001181500.1.73849 WP_001181500.1.73901 WP_001181500.1.73926 WP_001181500.1.73948 WP_001181500.1.73999 WP_001181500.1.74024 WP_001181500.1.74028 WP_001181500.1.74030 WP_001181500.1.74038 WP_001181500.1.74040 WP_001181500.1.74043 WP_001181500.1.74058 WP_001181500.1.74070 WP_001181500.1.74077 WP_001181500.1.74089 WP_001181500.1.74117 WP_001181500.1.74135 WP_001181500.1.74174 WP_001181500.1.74207 WP_001181500.1.74214 WP_001181500.1.74228 WP_001181500.1.74241 WP_001181500.1.74248 WP_001181500.1.74285 WP_001181500.1.743 WP_001181500.1.7430 WP_001181500.1.74300 WP_001181500.1.74317 WP_001181500.1.74414 WP_001181500.1.74415 WP_001181500.1.74422 WP_001181500.1.7444 WP_001181500.1.74454 WP_001181500.1.74469 WP_001181500.1.74481 WP_001181500.1.745 WP_001181500.1.74570 WP_001181500.1.74578 WP_001181500.1.7458 WP_001181500.1.74616 WP_001181500.1.74621 WP_001181500.1.74632 WP_001181500.1.74639 WP_001181500.1.74647 WP_001181500.1.74661 WP_001181500.1.74677 WP_001181500.1.74699 WP_001181500.1.74757 WP_001181500.1.74806 WP_001181500.1.74831 WP_001181500.1.74876 WP_001181500.1.74884 WP_001181500.1.74894 WP_001181500.1.7491 WP_001181500.1.74929 WP_001181500.1.74939 WP_001181500.1.74946 WP_001181500.1.74972 WP_001181500.1.74973 WP_001181500.1.74992 WP_001181500.1.75009 WP_001181500.1.75051 WP_001181500.1.75056 WP_001181500.1.75058 WP_001181500.1.7507 WP_001181500.1.75089 WP_001181500.1.75114 WP_001181500.1.75116 WP_001181500.1.75134 WP_001181500.1.75148 WP_001181500.1.75159 WP_001181500.1.75168 WP_001181500.1.75180 WP_001181500.1.75237 WP_001181500.1.75273 WP_001181500.1.75296 WP_001181500.1.75301 WP_001181500.1.75400 WP_001181500.1.75402 WP_001181500.1.75413 WP_001181500.1.75433 WP_001181500.1.75450 WP_001181500.1.75532 WP_001181500.1.75565 WP_001181500.1.7558 WP_001181500.1.75593 WP_001181500.1.75607 WP_001181500.1.75609 WP_001181500.1.75610 WP_001181500.1.75633 WP_001181500.1.75664 WP_001181500.1.75703 WP_001181500.1.75716 WP_001181500.1.75718 WP_001181500.1.75740 WP_001181500.1.75745 WP_001181500.1.75751 WP_001181500.1.75794 WP_001181500.1.75810 WP_001181500.1.75828 WP_001181500.1.75844 WP_001181500.1.75863 WP_001181500.1.75873 WP_001181500.1.75886 WP_001181500.1.75898 WP_001181500.1.75902 WP_001181500.1.75932 WP_001181500.1.75957 WP_001181500.1.76 WP_001181500.1.76055 WP_001181500.1.76081 WP_001181500.1.76097 WP_001181500.1.76102 WP_001181500.1.76108 WP_001181500.1.76116 WP_001181500.1.76122 WP_001181500.1.76137 WP_001181500.1.76156 WP_001181500.1.76164 WP_001181500.1.76170 WP_001181500.1.76186 WP_001181500.1.76197 WP_001181500.1.76256 WP_001181500.1.7629 WP_001181500.1.76301 WP_001181500.1.76327 WP_001181500.1.76339 WP_001181500.1.76345 WP_001181500.1.76364 WP_001181500.1.76366 WP_001181500.1.76417 WP_001181500.1.76434 WP_001181500.1.76451 WP_001181500.1.7646 WP_001181500.1.76495 WP_001181500.1.76510 WP_001181500.1.76532 WP_001181500.1.76548 WP_001181500.1.7655 WP_001181500.1.76558 WP_001181500.1.76572 WP_001181500.1.76576 WP_001181500.1.76611 WP_001181500.1.76641 WP_001181500.1.76651 WP_001181500.1.76653 WP_001181500.1.7672 WP_001181500.1.76724 WP_001181500.1.76776 WP_001181500.1.76788 WP_001181500.1.76799 WP_001181500.1.76806 WP_001181500.1.7684 WP_001181500.1.76854 WP_001181500.1.76866 WP_001181500.1.76913 WP_001181500.1.76916 WP_001181500.1.76932 WP_001181500.1.76968 WP_001181500.1.76973 WP_001181500.1.76988 WP_001181500.1.77016 WP_001181500.1.77017 WP_001181500.1.77067 WP_001181500.1.77087 WP_001181500.1.77090 WP_001181500.1.77111 WP_001181500.1.77177 WP_001181500.1.77184 WP_001181500.1.77193 WP_001181500.1.77241 WP_001181500.1.77267 WP_001181500.1.77271 WP_001181500.1.77299 WP_001181500.1.77306 WP_001181500.1.77356 WP_001181500.1.77384 WP_001181500.1.77390 WP_001181500.1.77431 WP_001181500.1.77436 WP_001181500.1.77440 WP_001181500.1.77475 WP_001181500.1.77496 WP_001181500.1.77501 WP_001181500.1.77512 WP_001181500.1.77513 WP_001181500.1.77563 WP_001181500.1.77575 WP_001181500.1.77596 WP_001181500.1.77629 WP_001181500.1.77653 WP_001181500.1.77702 WP_001181500.1.77710 WP_001181500.1.77713 WP_001181500.1.7772 WP_001181500.1.77754 WP_001181500.1.77825 WP_001181500.1.77837 WP_001181500.1.77871 WP_001181500.1.77900 WP_001181500.1.7792 WP_001181500.1.77923 WP_001181500.1.7793 WP_001181500.1.77951 WP_001181500.1.77971 WP_001181500.1.77975 WP_001181500.1.77983 WP_001181500.1.77989 WP_001181500.1.78 WP_001181500.1.78016 WP_001181500.1.7802 WP_001181500.1.78035 WP_001181500.1.78048 WP_001181500.1.78051 WP_001181500.1.78107 WP_001181500.1.7814 WP_001181500.1.78166 WP_001181500.1.78168 WP_001181500.1.78170 WP_001181500.1.78180 WP_001181500.1.78192 WP_001181500.1.78195 WP_001181500.1.78201 WP_001181500.1.78245 WP_001181500.1.78259 WP_001181500.1.78291 WP_001181500.1.78301 WP_001181500.1.78309 WP_001181500.1.78320 WP_001181500.1.78339 WP_001181500.1.78366 WP_001181500.1.78372 WP_001181500.1.78382 WP_001181500.1.78388 WP_001181500.1.78410 WP_001181500.1.78443 WP_001181500.1.78495 WP_001181500.1.78496 WP_001181500.1.78501 WP_001181500.1.78603 WP_001181500.1.7862 WP_001181500.1.78626 WP_001181500.1.78632 WP_001181500.1.78658 WP_001181500.1.78661 WP_001181500.1.78674 WP_001181500.1.78676 WP_001181500.1.78697 WP_001181500.1.78734 WP_001181500.1.78738 WP_001181500.1.78761 WP_001181500.1.7877 WP_001181500.1.78789 WP_001181500.1.78815 WP_001181500.1.78838 WP_001181500.1.78862 WP_001181500.1.78877 WP_001181500.1.78881 WP_001181500.1.78896 WP_001181500.1.789 WP_001181500.1.7891 WP_001181500.1.78913 WP_001181500.1.78928 WP_001181500.1.78993 WP_001181500.1.79011 WP_001181500.1.79012 WP_001181500.1.79032 WP_001181500.1.79069 WP_001181500.1.79074 WP_001181500.1.79081 WP_001181500.1.79098 WP_001181500.1.79099 WP_001181500.1.79140 WP_001181500.1.79155 WP_001181500.1.79164 WP_001181500.1.79203 WP_001181500.1.79204 WP_001181500.1.79280 WP_001181500.1.79289 WP_001181500.1.79302 WP_001181500.1.79370 WP_001181500.1.79397 WP_001181500.1.794 WP_001181500.1.79427 WP_001181500.1.79456 WP_001181500.1.79466 WP_001181500.1.79468 WP_001181500.1.79532 WP_001181500.1.79547 WP_001181500.1.7956 WP_001181500.1.79580 WP_001181500.1.79586 WP_001181500.1.79635 WP_001181500.1.79654 WP_001181500.1.7970 WP_001181500.1.79722 WP_001181500.1.79734 WP_001181500.1.79738 WP_001181500.1.79757 WP_001181500.1.79772 WP_001181500.1.7982 WP_001181500.1.79832 WP_001181500.1.79867 WP_001181500.1.79880 WP_001181500.1.79892 WP_001181500.1.79914 WP_001181500.1.79916 WP_001181500.1.79929 WP_001181500.1.79934 WP_001181500.1.7994 WP_001181500.1.79945 WP_001181500.1.79966 WP_001181500.1.79974 WP_001181500.1.79996 WP_001181500.1.80065 WP_001181500.1.80103 WP_001181500.1.80149 WP_001181500.1.80229 WP_001181500.1.80236 WP_001181500.1.8024 WP_001181500.1.80249 WP_001181500.1.80250 WP_001181500.1.80254 WP_001181500.1.80273 WP_001181500.1.80282 WP_001181500.1.80307 WP_001181500.1.80333 WP_001181500.1.80354 WP_001181500.1.80368 WP_001181500.1.80380 WP_001181500.1.80386 WP_001181500.1.80400 WP_001181500.1.80443 WP_001181500.1.80462 WP_001181500.1.80473 WP_001181500.1.80479 WP_001181500.1.80480 WP_001181500.1.8049 WP_001181500.1.80492 WP_001181500.1.80496 WP_001181500.1.80529 WP_001181500.1.80542 WP_001181500.1.80569 WP_001181500.1.80609 WP_001181500.1.80629 WP_001181500.1.80638 WP_001181500.1.80651 WP_001181500.1.80664 WP_001181500.1.80667 WP_001181500.1.80674 WP_001181500.1.80696 WP_001181500.1.80707 WP_001181500.1.80723 WP_001181500.1.80741 WP_001181500.1.80757 WP_001181500.1.80760 WP_001181500.1.80803 WP_001181500.1.80819 WP_001181500.1.80827 WP_001181500.1.80840 WP_001181500.1.80857 WP_001181500.1.80868 WP_001181500.1.80874 WP_001181500.1.80876 WP_001181500.1.80913 WP_001181500.1.80927 WP_001181500.1.80984 WP_001181500.1.8106 WP_001181500.1.81062 WP_001181500.1.81107 WP_001181500.1.81109 WP_001181500.1.81110 WP_001181500.1.81118 WP_001181500.1.81131 WP_001181500.1.81187 WP_001181500.1.81197 WP_001181500.1.81225 WP_001181500.1.81231 WP_001181500.1.81262 WP_001181500.1.81268 WP_001181500.1.81269 WP_001181500.1.8127 WP_001181500.1.81271 WP_001181500.1.81275 WP_001181500.1.8130 WP_001181500.1.81302 WP_001181500.1.81305 WP_001181500.1.8131 WP_001181500.1.81321 WP_001181500.1.81328 WP_001181500.1.81333 WP_001181500.1.8134 WP_001181500.1.81342 WP_001181500.1.81364 WP_001181500.1.81388 WP_001181500.1.81404 WP_001181500.1.81409 WP_001181500.1.81410 WP_001181500.1.81455 WP_001181500.1.81494 WP_001181500.1.81504 WP_001181500.1.81528 WP_001181500.1.81548 WP_001181500.1.81557 WP_001181500.1.81668 WP_001181500.1.81676 WP_001181500.1.8168 WP_001181500.1.81681 WP_001181500.1.8170 WP_001181500.1.81727 WP_001181500.1.81735 WP_001181500.1.81736 WP_001181500.1.81743 WP_001181500.1.81746 WP_001181500.1.81760 WP_001181500.1.81763 WP_001181500.1.81768 WP_001181500.1.81795 WP_001181500.1.81855 WP_001181500.1.81921 WP_001181500.1.81931 WP_001181500.1.81936 WP_001181500.1.81941 WP_001181500.1.81949 WP_001181500.1.81965 WP_001181500.1.81995 WP_001181500.1.82037 WP_001181500.1.82070 WP_001181500.1.82076 WP_001181500.1.82099 WP_001181500.1.82131 WP_001181500.1.82141 WP_001181500.1.82144 WP_001181500.1.82149 WP_001181500.1.82156 WP_001181500.1.8218 WP_001181500.1.82180 WP_001181500.1.82192 WP_001181500.1.82201 WP_001181500.1.82214 WP_001181500.1.82225 WP_001181500.1.82232 WP_001181500.1.82258 WP_001181500.1.82269 WP_001181500.1.82347 WP_001181500.1.8236 WP_001181500.1.82369 WP_001181500.1.8240 WP_001181500.1.82401 WP_001181500.1.82408 WP_001181500.1.82416 WP_001181500.1.8242 WP_001181500.1.82420 WP_001181500.1.82434 WP_001181500.1.82456 WP_001181500.1.82464 WP_001181500.1.82465 WP_001181500.1.8247 WP_001181500.1.82473 WP_001181500.1.82474 WP_001181500.1.82530 WP_001181500.1.82553 WP_001181500.1.82562 WP_001181500.1.82569 WP_001181500.1.82570 WP_001181500.1.82584 WP_001181500.1.82636 WP_001181500.1.82646 WP_001181500.1.82648 WP_001181500.1.82670 WP_001181500.1.82731 WP_001181500.1.82763 WP_001181500.1.82812 WP_001181500.1.82841 WP_001181500.1.82843 WP_001181500.1.82850 WP_001181500.1.82872 WP_001181500.1.82886 WP_001181500.1.82908 WP_001181500.1.8294 WP_001181500.1.82946 WP_001181500.1.82959 WP_001181500.1.82964 WP_001181500.1.83005 WP_001181500.1.83006 WP_001181500.1.83007 WP_001181500.1.8304 WP_001181500.1.83119 WP_001181500.1.83128 WP_001181500.1.83180 WP_001181500.1.83204 WP_001181500.1.8322 WP_001181500.1.83221 WP_001181500.1.83229 WP_001181500.1.83235 WP_001181500.1.83252 WP_001181500.1.83258 WP_001181500.1.83290 WP_001181500.1.83301 WP_001181500.1.83331 WP_001181500.1.83333 WP_001181500.1.83354 WP_001181500.1.83356 WP_001181500.1.83360 WP_001181500.1.83365 WP_001181500.1.83378 WP_001181500.1.83407 WP_001181500.1.83516 WP_001181500.1.83558 WP_001181500.1.83650 WP_001181500.1.83651 WP_001181500.1.83657 WP_001181500.1.83677 WP_001181500.1.83710 WP_001181500.1.83739 WP_001181500.1.8375 WP_001181500.1.83854 WP_001181500.1.83897 WP_001181500.1.83923 WP_001181500.1.83960 WP_001181500.1.8399 WP_001181500.1.83994 WP_001181500.1.84 WP_001181500.1.84000 WP_001181500.1.84001 WP_001181500.1.84011 WP_001181500.1.8406 WP_001181500.1.84075 WP_001181500.1.84076 WP_001181500.1.84077 WP_001181500.1.84083 WP_001181500.1.84086 WP_001181500.1.84100 WP_001181500.1.84106 WP_001181500.1.84110 WP_001181500.1.84115 WP_001181500.1.84127 WP_001181500.1.84150 WP_001181500.1.84154 WP_001181500.1.84168 WP_001181500.1.84198 WP_001181500.1.84209 WP_001181500.1.84230 WP_001181500.1.8425 WP_001181500.1.84252 WP_001181500.1.84291 WP_001181500.1.84300 WP_001181500.1.8431 WP_001181500.1.84325 WP_001181500.1.84345 WP_001181500.1.84355 WP_001181500.1.84359 WP_001181500.1.84369 WP_001181500.1.84373 WP_001181500.1.84397 WP_001181500.1.84401 WP_001181500.1.84435 WP_001181500.1.84459 WP_001181500.1.84461 WP_001181500.1.84475 WP_001181500.1.84497 WP_001181500.1.84515 WP_001181500.1.84523 WP_001181500.1.84551 WP_001181500.1.84567 WP_001181500.1.84572 WP_001181500.1.84598 WP_001181500.1.84631 WP_001181500.1.84644 WP_001181500.1.84683 WP_001181500.1.84693 WP_001181500.1.84711 WP_001181500.1.84727 WP_001181500.1.84744 WP_001181500.1.84745 WP_001181500.1.84773 WP_001181500.1.84876 WP_001181500.1.849 WP_001181500.1.84945 WP_001181500.1.84967 WP_001181500.1.84983 WP_001181500.1.85004 WP_001181500.1.85014 WP_001181500.1.8502 WP_001181500.1.85039 WP_001181500.1.85079 WP_001181500.1.85094 WP_001181500.1.85147 WP_001181500.1.85153 WP_001181500.1.85192 WP_001181500.1.85217 WP_001181500.1.8526 WP_001181500.1.85271 WP_001181500.1.85273 WP_001181500.1.85301 WP_001181500.1.85338 WP_001181500.1.85339 WP_001181500.1.8537 WP_001181500.1.85408 WP_001181500.1.85433 WP_001181500.1.85456 WP_001181500.1.85511 WP_001181500.1.85512 WP_001181500.1.85568 WP_001181500.1.8557 WP_001181500.1.85606 WP_001181500.1.85646 WP_001181500.1.85654 WP_001181500.1.85665 WP_001181500.1.85669 WP_001181500.1.85675 WP_001181500.1.85688 WP_001181500.1.85703 WP_001181500.1.85723 WP_001181500.1.85728 WP_001181500.1.85742 WP_001181500.1.85746 WP_001181500.1.85759 WP_001181500.1.85780 WP_001181500.1.85784 WP_001181500.1.85797 WP_001181500.1.85811 WP_001181500.1.85854 WP_001181500.1.85855 WP_001181500.1.85864 WP_001181500.1.859 WP_001181500.1.8591 WP_001181500.1.85917 WP_001181500.1.8594 WP_001181500.1.85943 WP_001181500.1.85977 WP_001181500.1.860 WP_001181500.1.86007 WP_001181500.1.86010 WP_001181500.1.86017 WP_001181500.1.86043 WP_001181500.1.8605 WP_001181500.1.86084 WP_001181500.1.86092 WP_001181500.1.8610 WP_001181500.1.86126 WP_001181500.1.86138 WP_001181500.1.8614 WP_001181500.1.86156 WP_001181500.1.86157 WP_001181500.1.86159 WP_001181500.1.8616 WP_001181500.1.86173 WP_001181500.1.86206 WP_001181500.1.86224 WP_001181500.1.86240 WP_001181500.1.86284 WP_001181500.1.86285 WP_001181500.1.86323 WP_001181500.1.86335 WP_001181500.1.86342 WP_001181500.1.86347 WP_001181500.1.86380 WP_001181500.1.86389 WP_001181500.1.8640 WP_001181500.1.8642 WP_001181500.1.86426 WP_001181500.1.86442 WP_001181500.1.86453 WP_001181500.1.8647 WP_001181500.1.86489 WP_001181500.1.86514 WP_001181500.1.86530 WP_001181500.1.86593 WP_001181500.1.86601 WP_001181500.1.86634 WP_001181500.1.86656 WP_001181500.1.86658 WP_001181500.1.86663 WP_001181500.1.86676 WP_001181500.1.86699 WP_001181500.1.8671 WP_001181500.1.86744 WP_001181500.1.86770 WP_001181500.1.86794 WP_001181500.1.86800 WP_001181500.1.86807 WP_001181500.1.86811 WP_001181500.1.86815 WP_001181500.1.86859 WP_001181500.1.86860 WP_001181500.1.86902 WP_001181500.1.8691 WP_001181500.1.86915 WP_001181500.1.86945 WP_001181500.1.86989 WP_001181500.1.87023 WP_001181500.1.87034 WP_001181500.1.87038 WP_001181500.1.87041 WP_001181500.1.87051 WP_001181500.1.87136 WP_001181500.1.87148 WP_001181500.1.87155 WP_001181500.1.87187 WP_001181500.1.8722 WP_001181500.1.87258 WP_001181500.1.87265 WP_001181500.1.87282 WP_001181500.1.87293 WP_001181500.1.87365 WP_001181500.1.87420 WP_001181500.1.87484 WP_001181500.1.87493 WP_001181500.1.87500 WP_001181500.1.87528 WP_001181500.1.87560 WP_001181500.1.87583 WP_001181500.1.87584 WP_001181500.1.8760 WP_001181500.1.87600 WP_001181500.1.87609 WP_001181500.1.87612 WP_001181500.1.87615 WP_001181500.1.87653 WP_001181500.1.87659 WP_001181500.1.8767 WP_001181500.1.87687 WP_001181500.1.87695 WP_001181500.1.87698 WP_001181500.1.87706 WP_001181500.1.87712 WP_001181500.1.87739 WP_001181500.1.87741 WP_001181500.1.87742 WP_001181500.1.87760 WP_001181500.1.87813 WP_001181500.1.87852 WP_001181500.1.87875 WP_001181500.1.87899 WP_001181500.1.87905 WP_001181500.1.8792 WP_001181500.1.87933 WP_001181500.1.87936 WP_001181500.1.87949 WP_001181500.1.87999 WP_001181500.1.8800 WP_001181500.1.88014 WP_001181500.1.88025 WP_001181500.1.88026 WP_001181500.1.8805 WP_001181500.1.88052 WP_001181500.1.8806 WP_001181500.1.881 WP_001181500.1.88145 WP_001181500.1.88165 WP_001181500.1.88174 WP_001181500.1.88185 WP_001181500.1.88199 WP_001181500.1.88214 WP_001181500.1.88222 WP_001181500.1.88275 WP_001181500.1.88299 WP_001181500.1.88313 WP_001181500.1.88356 WP_001181500.1.88359 WP_001181500.1.88407 WP_001181500.1.88414 WP_001181500.1.88423 WP_001181500.1.88444 WP_001181500.1.88446 WP_001181500.1.88458 WP_001181500.1.88474 WP_001181500.1.88483 WP_001181500.1.8849 WP_001181500.1.88501 WP_001181500.1.88508 WP_001181500.1.88538 WP_001181500.1.88547 WP_001181500.1.88597 WP_001181500.1.886 WP_001181500.1.88620 WP_001181500.1.88624 WP_001181500.1.88647 WP_001181500.1.88648 WP_001181500.1.88683 WP_001181500.1.88692 WP_001181500.1.88698 WP_001181500.1.88707 WP_001181500.1.88727 WP_001181500.1.88731 WP_001181500.1.88762 WP_001181500.1.88772 WP_001181500.1.88776 WP_001181500.1.88845 WP_001181500.1.88850 WP_001181500.1.88854 WP_001181500.1.8889 WP_001181500.1.88892 WP_001181500.1.88894 WP_001181500.1.88942 WP_001181500.1.88957 WP_001181500.1.88966 WP_001181500.1.88967 WP_001181500.1.88968 WP_001181500.1.88970 WP_001181500.1.88980 WP_001181500.1.88982 WP_001181500.1.88995 WP_001181500.1.88998 WP_001181500.1.89054 WP_001181500.1.89114 WP_001181500.1.89119 WP_001181500.1.89120 WP_001181500.1.89174 WP_001181500.1.89177 WP_001181500.1.89182 WP_001181500.1.89188 WP_001181500.1.89215 WP_001181500.1.89221 WP_001181500.1.89291 WP_001181500.1.89298 WP_001181500.1.89308 WP_001181500.1.89311 WP_001181500.1.89314 WP_001181500.1.89328 WP_001181500.1.89332 WP_001181500.1.89343 WP_001181500.1.89362 WP_001181500.1.89395 WP_001181500.1.8940 WP_001181500.1.89408 WP_001181500.1.89425 WP_001181500.1.89449 WP_001181500.1.89452 WP_001181500.1.89462 WP_001181500.1.8947 WP_001181500.1.89503 WP_001181500.1.89591 WP_001181500.1.89606 WP_001181500.1.8961 WP_001181500.1.89612 WP_001181500.1.89632 WP_001181500.1.89647 WP_001181500.1.89668 WP_001181500.1.89680 WP_001181500.1.89706 WP_001181500.1.89713 WP_001181500.1.89733 WP_001181500.1.89765 WP_001181500.1.89777 WP_001181500.1.89789 WP_001181500.1.89796 WP_001181500.1.89804 WP_001181500.1.89815 WP_001181500.1.89817 WP_001181500.1.89832 WP_001181500.1.89845 WP_001181500.1.89870 WP_001181500.1.89888 WP_001181500.1.89911 WP_001181500.1.89914 WP_001181500.1.8995 WP_001181500.1.89952 WP_001181500.1.89965 WP_001181500.1.90007 WP_001181500.1.9003 WP_001181500.1.90033 WP_001181500.1.90084 WP_001181500.1.90108 WP_001181500.1.9011 WP_001181500.1.90196 WP_001181500.1.90211 WP_001181500.1.90220 WP_001181500.1.90240 WP_001181500.1.90274 WP_001181500.1.90280 WP_001181500.1.90293 WP_001181500.1.90311 WP_001181500.1.90330 WP_001181500.1.90338 WP_001181500.1.90365 WP_001181500.1.90421 WP_001181500.1.90428 WP_001181500.1.90440 WP_001181500.1.90472 WP_001181500.1.90489 WP_001181500.1.90513 WP_001181500.1.90522 WP_001181500.1.90540 WP_001181500.1.90563 WP_001181500.1.90566 WP_001181500.1.90582 WP_001181500.1.9064 WP_001181500.1.90713 WP_001181500.1.90748 WP_001181500.1.90759 WP_001181500.1.90792 WP_001181500.1.90794 WP_001181500.1.90796 WP_001181500.1.90811 WP_001181500.1.90814 WP_001181500.1.90859 WP_001181500.1.90876 WP_001181500.1.90878 WP_001181500.1.9091 WP_001181500.1.9093 WP_001181500.1.90959 WP_001181500.1.90973 WP_001181500.1.90983 WP_001181500.1.90984 WP_001181500.1.90991 WP_001181500.1.91049 WP_001181500.1.91056 WP_001181500.1.91067 WP_001181500.1.91107 WP_001181500.1.91156 WP_001181500.1.91179 WP_001181500.1.91189 WP_001181500.1.91205 WP_001181500.1.91215 WP_001181500.1.91239 WP_001181500.1.91291 WP_001181500.1.9131 WP_001181500.1.91313 WP_001181500.1.91334 WP_001181500.1.9135 WP_001181500.1.9137 WP_001181500.1.91372 WP_001181500.1.91405 WP_001181500.1.91424 WP_001181500.1.91459 WP_001181500.1.91470 WP_001181500.1.91474 WP_001181500.1.91493 WP_001181500.1.91505 WP_001181500.1.91506 WP_001181500.1.91524 WP_001181500.1.91528 WP_001181500.1.91557 WP_001181500.1.91597 WP_001181500.1.91621 WP_001181500.1.91625 WP_001181500.1.91702 WP_001181500.1.91715 WP_001181500.1.91736 WP_001181500.1.91742 WP_001181500.1.91772 WP_001181500.1.91776 WP_001181500.1.91795 WP_001181500.1.91864 WP_001181500.1.9187 WP_001181500.1.91870 WP_001181500.1.91880 WP_001181500.1.91898 WP_001181500.1.91904 WP_001181500.1.91974 WP_001181500.1.92018 WP_001181500.1.92044 WP_001181500.1.92060 WP_001181500.1.92067 WP_001181500.1.92068 WP_001181500.1.92082 WP_001181500.1.92087 WP_001181500.1.92098 WP_001181500.1.92099 WP_001181500.1.92122 WP_001181500.1.92129 WP_001181500.1.92156 WP_001181500.1.92165 WP_001181500.1.92171 WP_001181500.1.92172 WP_001181500.1.92213 WP_001181500.1.9222 WP_001181500.1.92240 WP_001181500.1.92243 WP_001181500.1.92270 WP_001181500.1.92327 WP_001181500.1.92375 WP_001181500.1.92394 WP_001181500.1.92399 WP_001181500.1.92408 WP_001181500.1.92411 WP_001181500.1.92452 WP_001181500.1.92470 WP_001181500.1.92477 WP_001181500.1.9253 WP_001181500.1.92545 WP_001181500.1.92557 WP_001181500.1.92562 WP_001181500.1.92570 WP_001181500.1.92575 WP_001181500.1.92588 WP_001181500.1.926 WP_001181500.1.92628 WP_001181500.1.92633 WP_001181500.1.92649 WP_001181500.1.92659 WP_001181500.1.92676 WP_001181500.1.92705 WP_001181500.1.9271 WP_001181500.1.92729 WP_001181500.1.92734 WP_001181500.1.92754 WP_001181500.1.92758 WP_001181500.1.92806 WP_001181500.1.92810 WP_001181500.1.92823 WP_001181500.1.92827 WP_001181500.1.92832 WP_001181500.1.92836 WP_001181500.1.92843 WP_001181500.1.92875 WP_001181500.1.92879 WP_001181500.1.92883 WP_001181500.1.92890 WP_001181500.1.92893 WP_001181500.1.92895 WP_001181500.1.92929 WP_001181500.1.92939 WP_001181500.1.92947 WP_001181500.1.92975 WP_001181500.1.92987 WP_001181500.1.92988 WP_001181500.1.93007 WP_001181500.1.93022 WP_001181500.1.93059 WP_001181500.1.93061 WP_001181500.1.93076 WP_001181500.1.93103 WP_001181500.1.93105 WP_001181500.1.93111 WP_001181500.1.93121 WP_001181500.1.93168 WP_001181500.1.93184 WP_001181500.1.93215 WP_001181500.1.93221 WP_001181500.1.93223 WP_001181500.1.93239 WP_001181500.1.93275 WP_001181500.1.93302 WP_001181500.1.93322 WP_001181500.1.93339 WP_001181500.1.93350 WP_001181500.1.9336 WP_001181500.1.93376 WP_001181500.1.93387 WP_001181500.1.93410 WP_001181500.1.93469 WP_001181500.1.93511 WP_001181500.1.93512 WP_001181500.1.93524 WP_001181500.1.93577 WP_001181500.1.93604 WP_001181500.1.93635 WP_001181500.1.93648 WP_001181500.1.93657 WP_001181500.1.93671 WP_001181500.1.93691 WP_001181500.1.9374 WP_001181500.1.9375 WP_001181500.1.93754 WP_001181500.1.93767 WP_001181500.1.93780 WP_001181500.1.9380 WP_001181500.1.93803 WP_001181500.1.93809 WP_001181500.1.93828 WP_001181500.1.93837 WP_001181500.1.93842 WP_001181500.1.93843 WP_001181500.1.93875 WP_001181500.1.93909 WP_001181500.1.93919 WP_001181500.1.93937 WP_001181500.1.93938 WP_001181500.1.93956 WP_001181500.1.93984 WP_001181500.1.93986 WP_001181500.1.9399 WP_001181500.1.94017 WP_001181500.1.94039 WP_001181500.1.94070 WP_001181500.1.94079 WP_001181500.1.94097 WP_001181500.1.94107 WP_001181500.1.94142 WP_001181500.1.94167 WP_001181500.1.94181 WP_001181500.1.94215 WP_001181500.1.94303 WP_001181500.1.94365 WP_001181500.1.94379 WP_001181500.1.94383 WP_001181500.1.94390 WP_001181500.1.9440 WP_001181500.1.94412 WP_001181500.1.94415 WP_001181500.1.94473 WP_001181500.1.94492 WP_001181500.1.94510 WP_001181500.1.94527 WP_001181500.1.94557 WP_001181500.1.94573 WP_001181500.1.94579 WP_001181500.1.94586 WP_001181500.1.94588 WP_001181500.1.94593 WP_001181500.1.94598 WP_001181500.1.94622 WP_001181500.1.9463 WP_001181500.1.94649 WP_001181500.1.94650 WP_001181500.1.94655 WP_001181500.1.94659 WP_001181500.1.94662 WP_001181500.1.94669 WP_001181500.1.94670 WP_001181500.1.94700 WP_001181500.1.94717 WP_001181500.1.94722 WP_001181500.1.94745 WP_001181500.1.94782 WP_001181500.1.94785 WP_001181500.1.9481 WP_001181500.1.94820 WP_001181500.1.94835 WP_001181500.1.94850 WP_001181500.1.94851 WP_001181500.1.94862 WP_001181500.1.94864 WP_001181500.1.94952 WP_001181500.1.94982 WP_001181500.1.94983 WP_001181500.1.94987 WP_001181500.1.95006 WP_001181500.1.9503 WP_001181500.1.95055 WP_001181500.1.95076 WP_001181500.1.95094 WP_001181500.1.95099 WP_001181500.1.95136 WP_001181500.1.95152 WP_001181500.1.95165 WP_001181500.1.95239 WP_001181500.1.95246 WP_001181500.1.95248 WP_001181500.1.95249 WP_001181500.1.9525 WP_001181500.1.95255 WP_001181500.1.95265 WP_001181500.1.9527 WP_001181500.1.95277 WP_001181500.1.9530 WP_001181500.1.95338 WP_001181500.1.95388 WP_001181500.1.95404 WP_001181500.1.95412 WP_001181500.1.95434 WP_001181500.1.95447 WP_001181500.1.95456 WP_001181500.1.95465 WP_001181500.1.95530 WP_001181500.1.95547 WP_001181500.1.95558 WP_001181500.1.95590 WP_001181500.1.95607 WP_001181500.1.95623 WP_001181500.1.95625 WP_001181500.1.95656 WP_001181500.1.95670 WP_001181500.1.95675 WP_001181500.1.95691 WP_001181500.1.95701 WP_001181500.1.95703 WP_001181500.1.95716 WP_001181500.1.95729 WP_001181500.1.95744 WP_001181500.1.95757 WP_001181500.1.95776 WP_001181500.1.95803 WP_001181500.1.95805 WP_001181500.1.95826 WP_001181500.1.9586 WP_001181500.1.95866 WP_001181500.1.95884 WP_001181500.1.95890 WP_001181500.1.95906 WP_001181500.1.95939 WP_001181500.1.95963 WP_001181500.1.96004 WP_001181500.1.96025 WP_001181500.1.96042 WP_001181500.1.96044 WP_001181500.1.96045 WP_001181500.1.96054 WP_001181500.1.96094 WP_001181500.1.96107 WP_001181500.1.96127 WP_001181500.1.96144 WP_001181500.1.96162 WP_001181500.1.96172 WP_001181500.1.96188 WP_001181500.1.96190 WP_001181500.1.96211 WP_001181500.1.96212 WP_001181500.1.9624 WP_001181500.1.96260 WP_001181500.1.96319 WP_001181500.1.9633 WP_001181500.1.96335 WP_001181500.1.96340 WP_001181500.1.96348 WP_001181500.1.96349 WP_001181500.1.96359 WP_001181500.1.96380 WP_001181500.1.96404 WP_001181500.1.96429 WP_001181500.1.96490 WP_001181500.1.96497 WP_001181500.1.96521 WP_001181500.1.96533 WP_001181500.1.96537 WP_001181500.1.96539 WP_001181500.1.96552 WP_001181500.1.96584 WP_001181500.1.96590 WP_001181500.1.96600 WP_001181500.1.96610 WP_001181500.1.96625 WP_001181500.1.96635 WP_001181500.1.9664 WP_001181500.1.96640 WP_001181500.1.96642 WP_001181500.1.96662 WP_001181500.1.96675 WP_001181500.1.9670 WP_001181500.1.96735 WP_001181500.1.9674 WP_001181500.1.96750 WP_001181500.1.96758 WP_001181500.1.96761 WP_001181500.1.96792 WP_001181500.1.96801 WP_001181500.1.96803 WP_001181500.1.9686 WP_001181500.1.96876 WP_001181500.1.96890 WP_001181500.1.96917 WP_001181500.1.96925 WP_001181500.1.96938 WP_001181500.1.96946 WP_001181500.1.96957 WP_001181500.1.96978 WP_001181500.1.96993 WP_001181500.1.97026 WP_001181500.1.97043 WP_001181500.1.97047 WP_001181500.1.97079 WP_001181500.1.97089 WP_001181500.1.97103 WP_001181500.1.97109 WP_001181500.1.97143 WP_001181500.1.97154 WP_001181500.1.97184 WP_001181500.1.97224 WP_001181500.1.97287 WP_001181500.1.97291 WP_001181500.1.97297 WP_001181500.1.97322 WP_001181500.1.97328 WP_001181500.1.97368 WP_001181500.1.97386 WP_001181500.1.97413 WP_001181500.1.97422 WP_001181500.1.97441 WP_001181500.1.97477 WP_001181500.1.97480 WP_001181500.1.97487 WP_001181500.1.97497 WP_001181500.1.97505 WP_001181500.1.97547 WP_001181500.1.97599 WP_001181500.1.97606 WP_001181500.1.97615 WP_001181500.1.97628 WP_001181500.1.97631 WP_001181500.1.97640 WP_001181500.1.97646 WP_001181500.1.97648 WP_001181500.1.97656 WP_001181500.1.97690 WP_001181500.1.97691 WP_001181500.1.97693 WP_001181500.1.97704 WP_001181500.1.97726 WP_001181500.1.9774 WP_001181500.1.97768 WP_001181500.1.97819 WP_001181500.1.97840 WP_001181500.1.9793 WP_001181500.1.97938 WP_001181500.1.97981 WP_001181500.1.97983 WP_001181500.1.9799 WP_001181500.1.97991 WP_001181500.1.98036 WP_001181500.1.98080 WP_001181500.1.98086 WP_001181500.1.98107 WP_001181500.1.9811 WP_001181500.1.98119 WP_001181500.1.98124 WP_001181500.1.98158 WP_001181500.1.98170 WP_001181500.1.98201 WP_001181500.1.98250 WP_001181500.1.9826 WP_001181500.1.98263 WP_001181500.1.98338 WP_001181500.1.98392 WP_001181500.1.98402 WP_001181500.1.98403 WP_001181500.1.98418 WP_001181500.1.98438 WP_001181500.1.98440 WP_001181500.1.98448 WP_001181500.1.98457 WP_001181500.1.98472 WP_001181500.1.9850 WP_001181500.1.98502 WP_001181500.1.98551 WP_001181500.1.98570 WP_001181500.1.98607 WP_001181500.1.9863 WP_001181500.1.98634 WP_001181500.1.98726 WP_001181500.1.98731 WP_001181500.1.98751 WP_001181500.1.98762 WP_001181500.1.9877 WP_001181500.1.98779 WP_001181500.1.98801 WP_001181500.1.98818 WP_001181500.1.9887 WP_001181500.1.98899 WP_001181500.1.98931 WP_001181500.1.98947 WP_001181500.1.9899 WP_001181500.1.99040 WP_001181500.1.99057 WP_001181500.1.99072 WP_001181500.1.99097 WP_001181500.1.99163 WP_001181500.1.99164 WP_001181500.1.99197 WP_001181500.1.99198 WP_001181500.1.99215 WP_001181500.1.99255 WP_001181500.1.99278 WP_001181500.1.99327 WP_001181500.1.99335 WP_001181500.1.99339 WP_001181500.1.99350 WP_001181500.1.99360 WP_001181500.1.99363 WP_001181500.1.99369 WP_001181500.1.99370 WP_001181500.1.99388 WP_001181500.1.99397 WP_001181500.1.99456 WP_001181500.1.99463 WP_001181500.1.99469 WP_001181500.1.99483 WP_001181500.1.99490 WP_001181500.1.99493 WP_001181500.1.99546 WP_001181500.1.99561 WP_001181500.1.99577 WP_001181500.1.99579 WP_001181500.1.99595 WP_001181500.1.99613 WP_001181500.1.99626 WP_001181500.1.99630 WP_001181500.1.99671 WP_001181500.1.99676 WP_001181500.1.99764 WP_001181500.1.99783 WP_001181500.1.99824 WP_001181500.1.99829 WP_001181500.1.99837 WP_001181500.1.99841 WP_001181500.1.9992 WP_001181500.1.99924 WP_001181500.1.99961 WP_001181500.1.99996 gi|386590652|ref|YP_006087052.1| gi|378960307|ref|YP_005217793.1| gi|549478722|ref|YP_008612564.1| 209261.t2140 220341.STY0779 439843.SeSA_A0892 439851.SeD_A0830 454166.SeAg_B0769 454169.SeHA_C0859 550537.SEN0686 gi|525947945|ref|YP_008309436.1| gi|207856180|ref|YP_002242831.1| gi|525816661|ref|YP_008246679.1| ABAK02000001|CDS_180961-183762 ABAM02000001|CDS_1300642-1303443 ABEH02000007|CDS_43394-46195 ABEI01000004|CDS_50594-53395 ABEJ01000023|CDS_42324-45125 ABEL01000001|CDS_546590-549391 ABEW01000014|CDS_16845-14044 ABFF01000006|CDS_189168-186367 ABFG01000015|CDS_33132-35933 AE014613|CDS_2204562-2201761 AL513382|CDS_776527-779328 AM933172|CDS_761127-763928 CP001120|CDS_850154-852955 CP001127|CDS_867494-870295 CP001138|CDS_765856-768657 CP001144|CDS_826678-829479 NZ_ACBF01000007|CDS_171498-174299 gi|378955899|ref|YP_005213386.1| gi|194450081|ref|YP_002044766.1| gi|525857033|ref|YP_008259970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]