SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488654935|ref|YP_007926738.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488654935|ref|YP_007926738.1|
Domain Number 1 Region: 10-199,243-381
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.28e-74
Family TK-like PP module 0.019
Further Details:      
 
Domain Number 2 Region: 318-504
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-58
Family TK-like Pyr module 0.024
Further Details:      
 
Domain Number 3 Region: 491-619
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-31
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488654935|ref|YP_007926738.1|
Sequence length 620
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELT
VALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSV
GHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILND
NEMSISENVGALNNHLARLLSGKLYSSLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPG
TLFEELGFNYIGPVDGHDVMGLISTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPITFHA
VPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFP
DRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDR
AGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGN
AQGVALTPLEKLPIGKGLVKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDD
TLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEA
RAELGLDAAGIEAKIKAWLA
Download sequence
Identical sequences Q8Z8X3
NP_455016.1.84458 WP_000006791.1.100008 WP_000006791.1.100036 WP_000006791.1.100079 WP_000006791.1.100196 WP_000006791.1.100284 WP_000006791.1.100313 WP_000006791.1.100314 WP_000006791.1.100321 WP_000006791.1.100354 WP_000006791.1.100421 WP_000006791.1.100446 WP_000006791.1.100450 WP_000006791.1.100592 WP_000006791.1.100610 WP_000006791.1.100732 WP_000006791.1.100733 WP_000006791.1.100739 WP_000006791.1.100764 WP_000006791.1.100799 WP_000006791.1.100941 WP_000006791.1.100953 WP_000006791.1.101011 WP_000006791.1.10108 WP_000006791.1.101226 WP_000006791.1.10124 WP_000006791.1.101271 WP_000006791.1.101312 WP_000006791.1.101322 WP_000006791.1.101374 WP_000006791.1.101616 WP_000006791.1.101890 WP_000006791.1.101941 WP_000006791.1.102050 WP_000006791.1.102087 WP_000006791.1.10338 WP_000006791.1.1038 WP_000006791.1.104 WP_000006791.1.10401 WP_000006791.1.10428 WP_000006791.1.10459 WP_000006791.1.10475 WP_000006791.1.10511 WP_000006791.1.10514 WP_000006791.1.10530 WP_000006791.1.10532 WP_000006791.1.10547 WP_000006791.1.10595 WP_000006791.1.10642 WP_000006791.1.10654 WP_000006791.1.10677 WP_000006791.1.10857 WP_000006791.1.10873 WP_000006791.1.10926 WP_000006791.1.10936 WP_000006791.1.11012 WP_000006791.1.11055 WP_000006791.1.11126 WP_000006791.1.11142 WP_000006791.1.11239 WP_000006791.1.11253 WP_000006791.1.11314 WP_000006791.1.11385 WP_000006791.1.1142 WP_000006791.1.11426 WP_000006791.1.11429 WP_000006791.1.11557 WP_000006791.1.11567 WP_000006791.1.11638 WP_000006791.1.11883 WP_000006791.1.11908 WP_000006791.1.11914 WP_000006791.1.12040 WP_000006791.1.12061 WP_000006791.1.1207 WP_000006791.1.12141 WP_000006791.1.12172 WP_000006791.1.12192 WP_000006791.1.1224 WP_000006791.1.12364 WP_000006791.1.12398 WP_000006791.1.12441 WP_000006791.1.12581 WP_000006791.1.12620 WP_000006791.1.12648 WP_000006791.1.12683 WP_000006791.1.12726 WP_000006791.1.12727 WP_000006791.1.12741 WP_000006791.1.12834 WP_000006791.1.13108 WP_000006791.1.13161 WP_000006791.1.1321 WP_000006791.1.13268 WP_000006791.1.13291 WP_000006791.1.133 WP_000006791.1.13314 WP_000006791.1.13338 WP_000006791.1.13342 WP_000006791.1.13352 WP_000006791.1.13406 WP_000006791.1.13440 WP_000006791.1.13443 WP_000006791.1.13476 WP_000006791.1.13599 WP_000006791.1.13686 WP_000006791.1.1372 WP_000006791.1.13732 WP_000006791.1.1382 WP_000006791.1.1397 WP_000006791.1.13972 WP_000006791.1.140 WP_000006791.1.1401 WP_000006791.1.1408 WP_000006791.1.14089 WP_000006791.1.14099 WP_000006791.1.14120 WP_000006791.1.14123 WP_000006791.1.14150 WP_000006791.1.14191 WP_000006791.1.14197 WP_000006791.1.14280 WP_000006791.1.14333 WP_000006791.1.14399 WP_000006791.1.14444 WP_000006791.1.14467 WP_000006791.1.14474 WP_000006791.1.14500 WP_000006791.1.14526 WP_000006791.1.14550 WP_000006791.1.14575 WP_000006791.1.14701 WP_000006791.1.14703 WP_000006791.1.14719 WP_000006791.1.1473 WP_000006791.1.14765 WP_000006791.1.14810 WP_000006791.1.14877 WP_000006791.1.14894 WP_000006791.1.14930 WP_000006791.1.14947 WP_000006791.1.14948 WP_000006791.1.15184 WP_000006791.1.15244 WP_000006791.1.15265 WP_000006791.1.15362 WP_000006791.1.15415 WP_000006791.1.15423 WP_000006791.1.15433 WP_000006791.1.15439 WP_000006791.1.15487 WP_000006791.1.15535 WP_000006791.1.15581 WP_000006791.1.15597 WP_000006791.1.15710 WP_000006791.1.15717 WP_000006791.1.15905 WP_000006791.1.15912 WP_000006791.1.15970 WP_000006791.1.16046 WP_000006791.1.16051 WP_000006791.1.16058 WP_000006791.1.16150 WP_000006791.1.16155 WP_000006791.1.1626 WP_000006791.1.16264 WP_000006791.1.16344 WP_000006791.1.16452 WP_000006791.1.16461 WP_000006791.1.16462 WP_000006791.1.16465 WP_000006791.1.16522 WP_000006791.1.16588 WP_000006791.1.16658 WP_000006791.1.16666 WP_000006791.1.16673 WP_000006791.1.1674 WP_000006791.1.16767 WP_000006791.1.16781 WP_000006791.1.16879 WP_000006791.1.16893 WP_000006791.1.16905 WP_000006791.1.16948 WP_000006791.1.17049 WP_000006791.1.17058 WP_000006791.1.17078 WP_000006791.1.17202 WP_000006791.1.17219 WP_000006791.1.1722 WP_000006791.1.17302 WP_000006791.1.17308 WP_000006791.1.17368 WP_000006791.1.17405 WP_000006791.1.17406 WP_000006791.1.17513 WP_000006791.1.17543 WP_000006791.1.17563 WP_000006791.1.17578 WP_000006791.1.17622 WP_000006791.1.17659 WP_000006791.1.17667 WP_000006791.1.17686 WP_000006791.1.17741 WP_000006791.1.17840 WP_000006791.1.17956 WP_000006791.1.18005 WP_000006791.1.1801 WP_000006791.1.18021 WP_000006791.1.18099 WP_000006791.1.18124 WP_000006791.1.18144 WP_000006791.1.18173 WP_000006791.1.18270 WP_000006791.1.18280 WP_000006791.1.18328 WP_000006791.1.18358 WP_000006791.1.18370 WP_000006791.1.18406 WP_000006791.1.18474 WP_000006791.1.18513 WP_000006791.1.18610 WP_000006791.1.18678 WP_000006791.1.18722 WP_000006791.1.18766 WP_000006791.1.1880 WP_000006791.1.1885 WP_000006791.1.18860 WP_000006791.1.18922 WP_000006791.1.18959 WP_000006791.1.19001 WP_000006791.1.19006 WP_000006791.1.19044 WP_000006791.1.19084 WP_000006791.1.19187 WP_000006791.1.19228 WP_000006791.1.19288 WP_000006791.1.19300 WP_000006791.1.19422 WP_000006791.1.19454 WP_000006791.1.19456 WP_000006791.1.19496 WP_000006791.1.19535 WP_000006791.1.19538 WP_000006791.1.19589 WP_000006791.1.19663 WP_000006791.1.19686 WP_000006791.1.19731 WP_000006791.1.19794 WP_000006791.1.1992 WP_000006791.1.19999 WP_000006791.1.20254 WP_000006791.1.20255 WP_000006791.1.20296 WP_000006791.1.20339 WP_000006791.1.20419 WP_000006791.1.20465 WP_000006791.1.20492 WP_000006791.1.2053 WP_000006791.1.20635 WP_000006791.1.20718 WP_000006791.1.2073 WP_000006791.1.20740 WP_000006791.1.20828 WP_000006791.1.2087 WP_000006791.1.20883 WP_000006791.1.20947 WP_000006791.1.20953 WP_000006791.1.21010 WP_000006791.1.2106 WP_000006791.1.21062 WP_000006791.1.21144 WP_000006791.1.21162 WP_000006791.1.21184 WP_000006791.1.21185 WP_000006791.1.21366 WP_000006791.1.21492 WP_000006791.1.2166 WP_000006791.1.21674 WP_000006791.1.21946 WP_000006791.1.21966 WP_000006791.1.22064 WP_000006791.1.22118 WP_000006791.1.22126 WP_000006791.1.2216 WP_000006791.1.22208 WP_000006791.1.2227 WP_000006791.1.22373 WP_000006791.1.22476 WP_000006791.1.22614 WP_000006791.1.22652 WP_000006791.1.22683 WP_000006791.1.2284 WP_000006791.1.22895 WP_000006791.1.22926 WP_000006791.1.22943 WP_000006791.1.22967 WP_000006791.1.23040 WP_000006791.1.23058 WP_000006791.1.23218 WP_000006791.1.2331 WP_000006791.1.2332 WP_000006791.1.23340 WP_000006791.1.2336 WP_000006791.1.23365 WP_000006791.1.23412 WP_000006791.1.23426 WP_000006791.1.23492 WP_000006791.1.23515 WP_000006791.1.23548 WP_000006791.1.23571 WP_000006791.1.23604 WP_000006791.1.23679 WP_000006791.1.23728 WP_000006791.1.2375 WP_000006791.1.23783 WP_000006791.1.23786 WP_000006791.1.23787 WP_000006791.1.23801 WP_000006791.1.24028 WP_000006791.1.24061 WP_000006791.1.24083 WP_000006791.1.24117 WP_000006791.1.24125 WP_000006791.1.24138 WP_000006791.1.24153 WP_000006791.1.24291 WP_000006791.1.24322 WP_000006791.1.24355 WP_000006791.1.24375 WP_000006791.1.24400 WP_000006791.1.24420 WP_000006791.1.24619 WP_000006791.1.24643 WP_000006791.1.24688 WP_000006791.1.24716 WP_000006791.1.2481 WP_000006791.1.24832 WP_000006791.1.24964 WP_000006791.1.25017 WP_000006791.1.25032 WP_000006791.1.25041 WP_000006791.1.25053 WP_000006791.1.25140 WP_000006791.1.25185 WP_000006791.1.25196 WP_000006791.1.25210 WP_000006791.1.25219 WP_000006791.1.25304 WP_000006791.1.25374 WP_000006791.1.25475 WP_000006791.1.25490 WP_000006791.1.25508 WP_000006791.1.25512 WP_000006791.1.25603 WP_000006791.1.2562 WP_000006791.1.25666 WP_000006791.1.25807 WP_000006791.1.25821 WP_000006791.1.25833 WP_000006791.1.25835 WP_000006791.1.25882 WP_000006791.1.25911 WP_000006791.1.25962 WP_000006791.1.25963 WP_000006791.1.26001 WP_000006791.1.26027 WP_000006791.1.26107 WP_000006791.1.2615 WP_000006791.1.26217 WP_000006791.1.26230 WP_000006791.1.26232 WP_000006791.1.26272 WP_000006791.1.26286 WP_000006791.1.26288 WP_000006791.1.26394 WP_000006791.1.26491 WP_000006791.1.2654 WP_000006791.1.26554 WP_000006791.1.26636 WP_000006791.1.26689 WP_000006791.1.2679 WP_000006791.1.26908 WP_000006791.1.2692 WP_000006791.1.26928 WP_000006791.1.270 WP_000006791.1.27008 WP_000006791.1.27027 WP_000006791.1.27070 WP_000006791.1.27077 WP_000006791.1.27086 WP_000006791.1.27087 WP_000006791.1.27111 WP_000006791.1.27115 WP_000006791.1.2713 WP_000006791.1.2717 WP_000006791.1.27228 WP_000006791.1.27282 WP_000006791.1.27285 WP_000006791.1.27309 WP_000006791.1.27329 WP_000006791.1.27361 WP_000006791.1.27565 WP_000006791.1.27595 WP_000006791.1.27598 WP_000006791.1.27706 WP_000006791.1.27775 WP_000006791.1.27785 WP_000006791.1.27900 WP_000006791.1.27928 WP_000006791.1.27945 WP_000006791.1.28004 WP_000006791.1.2809 WP_000006791.1.28155 WP_000006791.1.28198 WP_000006791.1.2822 WP_000006791.1.28229 WP_000006791.1.28384 WP_000006791.1.28386 WP_000006791.1.28395 WP_000006791.1.284 WP_000006791.1.2845 WP_000006791.1.28479 WP_000006791.1.28627 WP_000006791.1.28692 WP_000006791.1.2873 WP_000006791.1.28917 WP_000006791.1.28962 WP_000006791.1.29023 WP_000006791.1.29042 WP_000006791.1.2905 WP_000006791.1.2907 WP_000006791.1.29081 WP_000006791.1.29089 WP_000006791.1.29153 WP_000006791.1.29203 WP_000006791.1.29237 WP_000006791.1.29248 WP_000006791.1.29288 WP_000006791.1.29389 WP_000006791.1.29439 WP_000006791.1.2946 WP_000006791.1.29462 WP_000006791.1.29563 WP_000006791.1.29727 WP_000006791.1.29743 WP_000006791.1.29782 WP_000006791.1.29833 WP_000006791.1.29851 WP_000006791.1.29865 WP_000006791.1.29886 WP_000006791.1.29919 WP_000006791.1.2994 WP_000006791.1.29964 WP_000006791.1.29983 WP_000006791.1.30009 WP_000006791.1.30013 WP_000006791.1.3002 WP_000006791.1.30034 WP_000006791.1.30049 WP_000006791.1.30058 WP_000006791.1.30172 WP_000006791.1.30185 WP_000006791.1.30354 WP_000006791.1.30357 WP_000006791.1.30362 WP_000006791.1.3042 WP_000006791.1.30421 WP_000006791.1.30440 WP_000006791.1.30448 WP_000006791.1.30489 WP_000006791.1.30517 WP_000006791.1.30542 WP_000006791.1.30544 WP_000006791.1.30556 WP_000006791.1.30572 WP_000006791.1.30585 WP_000006791.1.30618 WP_000006791.1.30664 WP_000006791.1.30688 WP_000006791.1.30806 WP_000006791.1.30967 WP_000006791.1.31046 WP_000006791.1.31066 WP_000006791.1.31078 WP_000006791.1.31139 WP_000006791.1.31145 WP_000006791.1.31182 WP_000006791.1.31205 WP_000006791.1.3121 WP_000006791.1.31223 WP_000006791.1.31303 WP_000006791.1.3131 WP_000006791.1.31352 WP_000006791.1.31389 WP_000006791.1.31413 WP_000006791.1.31446 WP_000006791.1.31533 WP_000006791.1.31799 WP_000006791.1.31836 WP_000006791.1.31951 WP_000006791.1.32041 WP_000006791.1.32042 WP_000006791.1.3207 WP_000006791.1.32189 WP_000006791.1.32202 WP_000006791.1.32263 WP_000006791.1.32293 WP_000006791.1.32299 WP_000006791.1.32422 WP_000006791.1.32425 WP_000006791.1.32458 WP_000006791.1.32460 WP_000006791.1.32529 WP_000006791.1.32563 WP_000006791.1.32578 WP_000006791.1.32617 WP_000006791.1.3270 WP_000006791.1.32725 WP_000006791.1.32838 WP_000006791.1.32848 WP_000006791.1.32868 WP_000006791.1.3290 WP_000006791.1.32940 WP_000006791.1.32941 WP_000006791.1.3296 WP_000006791.1.32966 WP_000006791.1.32985 WP_000006791.1.33037 WP_000006791.1.3305 WP_000006791.1.33051 WP_000006791.1.33065 WP_000006791.1.33122 WP_000006791.1.3315 WP_000006791.1.33208 WP_000006791.1.33214 WP_000006791.1.33247 WP_000006791.1.33280 WP_000006791.1.33283 WP_000006791.1.33313 WP_000006791.1.33339 WP_000006791.1.33382 WP_000006791.1.33490 WP_000006791.1.33501 WP_000006791.1.33529 WP_000006791.1.33689 WP_000006791.1.3370 WP_000006791.1.33730 WP_000006791.1.33741 WP_000006791.1.33840 WP_000006791.1.3392 WP_000006791.1.33926 WP_000006791.1.33957 WP_000006791.1.33969 WP_000006791.1.34001 WP_000006791.1.34059 WP_000006791.1.34118 WP_000006791.1.34211 WP_000006791.1.34214 WP_000006791.1.34234 WP_000006791.1.34284 WP_000006791.1.34376 WP_000006791.1.34382 WP_000006791.1.34484 WP_000006791.1.34517 WP_000006791.1.34530 WP_000006791.1.34665 WP_000006791.1.34694 WP_000006791.1.34751 WP_000006791.1.34808 WP_000006791.1.34824 WP_000006791.1.34834 WP_000006791.1.34932 WP_000006791.1.34962 WP_000006791.1.35001 WP_000006791.1.35040 WP_000006791.1.35074 WP_000006791.1.35175 WP_000006791.1.35240 WP_000006791.1.35274 WP_000006791.1.35532 WP_000006791.1.35560 WP_000006791.1.3557 WP_000006791.1.35628 WP_000006791.1.3570 WP_000006791.1.35712 WP_000006791.1.35713 WP_000006791.1.35736 WP_000006791.1.35791 WP_000006791.1.35795 WP_000006791.1.35870 WP_000006791.1.35916 WP_000006791.1.35938 WP_000006791.1.35966 WP_000006791.1.36000 WP_000006791.1.36034 WP_000006791.1.36036 WP_000006791.1.36069 WP_000006791.1.36291 WP_000006791.1.36298 WP_000006791.1.36308 WP_000006791.1.36323 WP_000006791.1.36343 WP_000006791.1.36460 WP_000006791.1.3649 WP_000006791.1.36495 WP_000006791.1.36526 WP_000006791.1.36567 WP_000006791.1.36579 WP_000006791.1.36617 WP_000006791.1.36618 WP_000006791.1.36643 WP_000006791.1.36663 WP_000006791.1.36701 WP_000006791.1.36725 WP_000006791.1.36779 WP_000006791.1.36798 WP_000006791.1.36802 WP_000006791.1.36821 WP_000006791.1.36853 WP_000006791.1.36950 WP_000006791.1.37014 WP_000006791.1.37133 WP_000006791.1.37176 WP_000006791.1.37199 WP_000006791.1.37200 WP_000006791.1.37258 WP_000006791.1.37303 WP_000006791.1.37513 WP_000006791.1.37584 WP_000006791.1.37590 WP_000006791.1.37593 WP_000006791.1.37600 WP_000006791.1.37613 WP_000006791.1.37659 WP_000006791.1.37662 WP_000006791.1.37675 WP_000006791.1.37691 WP_000006791.1.37761 WP_000006791.1.37775 WP_000006791.1.37777 WP_000006791.1.378 WP_000006791.1.379 WP_000006791.1.37911 WP_000006791.1.37941 WP_000006791.1.37985 WP_000006791.1.38061 WP_000006791.1.38064 WP_000006791.1.38108 WP_000006791.1.3816 WP_000006791.1.38207 WP_000006791.1.38261 WP_000006791.1.38266 WP_000006791.1.38310 WP_000006791.1.3834 WP_000006791.1.38351 WP_000006791.1.3838 WP_000006791.1.38381 WP_000006791.1.38440 WP_000006791.1.38486 WP_000006791.1.38515 WP_000006791.1.38595 WP_000006791.1.3860 WP_000006791.1.38642 WP_000006791.1.38734 WP_000006791.1.38877 WP_000006791.1.38983 WP_000006791.1.38996 WP_000006791.1.39056 WP_000006791.1.3907 WP_000006791.1.39105 WP_000006791.1.3914 WP_000006791.1.39147 WP_000006791.1.39161 WP_000006791.1.39210 WP_000006791.1.39235 WP_000006791.1.3931 WP_000006791.1.39435 WP_000006791.1.39502 WP_000006791.1.39530 WP_000006791.1.39619 WP_000006791.1.39620 WP_000006791.1.39624 WP_000006791.1.39659 WP_000006791.1.39667 WP_000006791.1.39775 WP_000006791.1.39879 WP_000006791.1.39890 WP_000006791.1.39941 WP_000006791.1.39945 WP_000006791.1.39947 WP_000006791.1.40095 WP_000006791.1.40097 WP_000006791.1.401 WP_000006791.1.40160 WP_000006791.1.40167 WP_000006791.1.40279 WP_000006791.1.40361 WP_000006791.1.4042 WP_000006791.1.40467 WP_000006791.1.40496 WP_000006791.1.40517 WP_000006791.1.40698 WP_000006791.1.40750 WP_000006791.1.40763 WP_000006791.1.40854 WP_000006791.1.4089 WP_000006791.1.40924 WP_000006791.1.40932 WP_000006791.1.40946 WP_000006791.1.41004 WP_000006791.1.4106 WP_000006791.1.41070 WP_000006791.1.41074 WP_000006791.1.41075 WP_000006791.1.41097 WP_000006791.1.41132 WP_000006791.1.41176 WP_000006791.1.41251 WP_000006791.1.41258 WP_000006791.1.41305 WP_000006791.1.41321 WP_000006791.1.41333 WP_000006791.1.41335 WP_000006791.1.4136 WP_000006791.1.41415 WP_000006791.1.41459 WP_000006791.1.41498 WP_000006791.1.41519 WP_000006791.1.41524 WP_000006791.1.41631 WP_000006791.1.41658 WP_000006791.1.41659 WP_000006791.1.41716 WP_000006791.1.41746 WP_000006791.1.41824 WP_000006791.1.41825 WP_000006791.1.41836 WP_000006791.1.41894 WP_000006791.1.41919 WP_000006791.1.41929 WP_000006791.1.4194 WP_000006791.1.42069 WP_000006791.1.42081 WP_000006791.1.42090 WP_000006791.1.42111 WP_000006791.1.42187 WP_000006791.1.42200 WP_000006791.1.42219 WP_000006791.1.42257 WP_000006791.1.42261 WP_000006791.1.42349 WP_000006791.1.42364 WP_000006791.1.42371 WP_000006791.1.42379 WP_000006791.1.42391 WP_000006791.1.42399 WP_000006791.1.42539 WP_000006791.1.42603 WP_000006791.1.42650 WP_000006791.1.4267 WP_000006791.1.42701 WP_000006791.1.42805 WP_000006791.1.42815 WP_000006791.1.42859 WP_000006791.1.4298 WP_000006791.1.43008 WP_000006791.1.43016 WP_000006791.1.43019 WP_000006791.1.43065 WP_000006791.1.43068 WP_000006791.1.43069 WP_000006791.1.43128 WP_000006791.1.43141 WP_000006791.1.43157 WP_000006791.1.43161 WP_000006791.1.43190 WP_000006791.1.43198 WP_000006791.1.4326 WP_000006791.1.43290 WP_000006791.1.43292 WP_000006791.1.43307 WP_000006791.1.43513 WP_000006791.1.43633 WP_000006791.1.43637 WP_000006791.1.43651 WP_000006791.1.43722 WP_000006791.1.43801 WP_000006791.1.43812 WP_000006791.1.43878 WP_000006791.1.43888 WP_000006791.1.43919 WP_000006791.1.43974 WP_000006791.1.44049 WP_000006791.1.44101 WP_000006791.1.44160 WP_000006791.1.44180 WP_000006791.1.44196 WP_000006791.1.44248 WP_000006791.1.44262 WP_000006791.1.44268 WP_000006791.1.4427 WP_000006791.1.44296 WP_000006791.1.44343 WP_000006791.1.44351 WP_000006791.1.44360 WP_000006791.1.44416 WP_000006791.1.44431 WP_000006791.1.44437 WP_000006791.1.44546 WP_000006791.1.4468 WP_000006791.1.44762 WP_000006791.1.44815 WP_000006791.1.44828 WP_000006791.1.44879 WP_000006791.1.44917 WP_000006791.1.4501 WP_000006791.1.45072 WP_000006791.1.45093 WP_000006791.1.45136 WP_000006791.1.45241 WP_000006791.1.45435 WP_000006791.1.45523 WP_000006791.1.45596 WP_000006791.1.45648 WP_000006791.1.45829 WP_000006791.1.45871 WP_000006791.1.46030 WP_000006791.1.46077 WP_000006791.1.46169 WP_000006791.1.46225 WP_000006791.1.46241 WP_000006791.1.46307 WP_000006791.1.46355 WP_000006791.1.464 WP_000006791.1.46454 WP_000006791.1.46461 WP_000006791.1.46504 WP_000006791.1.46505 WP_000006791.1.46551 WP_000006791.1.46559 WP_000006791.1.46701 WP_000006791.1.46781 WP_000006791.1.46816 WP_000006791.1.46842 WP_000006791.1.4690 WP_000006791.1.46920 WP_000006791.1.46945 WP_000006791.1.47036 WP_000006791.1.47037 WP_000006791.1.47042 WP_000006791.1.47059 WP_000006791.1.47085 WP_000006791.1.47123 WP_000006791.1.47215 WP_000006791.1.47245 WP_000006791.1.47523 WP_000006791.1.47531 WP_000006791.1.47532 WP_000006791.1.47605 WP_000006791.1.47630 WP_000006791.1.4774 WP_000006791.1.47756 WP_000006791.1.4781 WP_000006791.1.47886 WP_000006791.1.47898 WP_000006791.1.48019 WP_000006791.1.48100 WP_000006791.1.48114 WP_000006791.1.48139 WP_000006791.1.48190 WP_000006791.1.48292 WP_000006791.1.48324 WP_000006791.1.48426 WP_000006791.1.48430 WP_000006791.1.48436 WP_000006791.1.48586 WP_000006791.1.4859 WP_000006791.1.48591 WP_000006791.1.48610 WP_000006791.1.48631 WP_000006791.1.48663 WP_000006791.1.48690 WP_000006791.1.48734 WP_000006791.1.48756 WP_000006791.1.48778 WP_000006791.1.48849 WP_000006791.1.48955 WP_000006791.1.48963 WP_000006791.1.48973 WP_000006791.1.49004 WP_000006791.1.49106 WP_000006791.1.49117 WP_000006791.1.49121 WP_000006791.1.4914 WP_000006791.1.49140 WP_000006791.1.49153 WP_000006791.1.49166 WP_000006791.1.49355 WP_000006791.1.49429 WP_000006791.1.49434 WP_000006791.1.49450 WP_000006791.1.495 WP_000006791.1.49545 WP_000006791.1.49703 WP_000006791.1.49769 WP_000006791.1.49846 WP_000006791.1.4991 WP_000006791.1.49947 WP_000006791.1.49959 WP_000006791.1.49997 WP_000006791.1.50014 WP_000006791.1.50030 WP_000006791.1.50043 WP_000006791.1.50103 WP_000006791.1.50158 WP_000006791.1.50247 WP_000006791.1.50308 WP_000006791.1.50309 WP_000006791.1.50387 WP_000006791.1.50406 WP_000006791.1.50468 WP_000006791.1.5051 WP_000006791.1.50566 WP_000006791.1.50570 WP_000006791.1.50626 WP_000006791.1.50726 WP_000006791.1.50771 WP_000006791.1.50875 WP_000006791.1.50885 WP_000006791.1.509 WP_000006791.1.50929 WP_000006791.1.50970 WP_000006791.1.51040 WP_000006791.1.51048 WP_000006791.1.51100 WP_000006791.1.51134 WP_000006791.1.51227 WP_000006791.1.5127 WP_000006791.1.51305 WP_000006791.1.51315 WP_000006791.1.5136 WP_000006791.1.51474 WP_000006791.1.51519 WP_000006791.1.51598 WP_000006791.1.51644 WP_000006791.1.51724 WP_000006791.1.51734 WP_000006791.1.51838 WP_000006791.1.51863 WP_000006791.1.51935 WP_000006791.1.52057 WP_000006791.1.52114 WP_000006791.1.52129 WP_000006791.1.52191 WP_000006791.1.52202 WP_000006791.1.52209 WP_000006791.1.52339 WP_000006791.1.52469 WP_000006791.1.52571 WP_000006791.1.526 WP_000006791.1.52647 WP_000006791.1.52742 WP_000006791.1.52773 WP_000006791.1.52795 WP_000006791.1.52807 WP_000006791.1.52887 WP_000006791.1.53092 WP_000006791.1.53141 WP_000006791.1.53151 WP_000006791.1.53154 WP_000006791.1.53159 WP_000006791.1.53210 WP_000006791.1.53233 WP_000006791.1.53307 WP_000006791.1.53321 WP_000006791.1.53368 WP_000006791.1.53375 WP_000006791.1.53450 WP_000006791.1.5349 WP_000006791.1.53540 WP_000006791.1.53555 WP_000006791.1.53559 WP_000006791.1.5356 WP_000006791.1.53571 WP_000006791.1.5358 WP_000006791.1.53692 WP_000006791.1.53723 WP_000006791.1.5374 WP_000006791.1.53750 WP_000006791.1.53800 WP_000006791.1.53815 WP_000006791.1.53839 WP_000006791.1.53892 WP_000006791.1.53898 WP_000006791.1.53902 WP_000006791.1.53958 WP_000006791.1.53981 WP_000006791.1.53984 WP_000006791.1.54132 WP_000006791.1.54170 WP_000006791.1.54175 WP_000006791.1.54203 WP_000006791.1.54259 WP_000006791.1.5430 WP_000006791.1.54371 WP_000006791.1.54431 WP_000006791.1.54442 WP_000006791.1.54482 WP_000006791.1.54589 WP_000006791.1.54667 WP_000006791.1.54678 WP_000006791.1.54681 WP_000006791.1.54748 WP_000006791.1.5481 WP_000006791.1.54865 WP_000006791.1.54935 WP_000006791.1.54979 WP_000006791.1.55010 WP_000006791.1.55034 WP_000006791.1.55163 WP_000006791.1.55165 WP_000006791.1.55215 WP_000006791.1.55290 WP_000006791.1.55310 WP_000006791.1.55317 WP_000006791.1.55379 WP_000006791.1.5539 WP_000006791.1.55468 WP_000006791.1.55506 WP_000006791.1.55604 WP_000006791.1.55639 WP_000006791.1.55699 WP_000006791.1.55725 WP_000006791.1.55780 WP_000006791.1.55967 WP_000006791.1.56144 WP_000006791.1.56172 WP_000006791.1.5621 WP_000006791.1.56226 WP_000006791.1.56311 WP_000006791.1.56419 WP_000006791.1.56423 WP_000006791.1.56535 WP_000006791.1.56585 WP_000006791.1.56640 WP_000006791.1.56724 WP_000006791.1.56825 WP_000006791.1.56887 WP_000006791.1.56889 WP_000006791.1.56981 WP_000006791.1.57101 WP_000006791.1.57137 WP_000006791.1.57147 WP_000006791.1.57179 WP_000006791.1.57186 WP_000006791.1.57342 WP_000006791.1.57684 WP_000006791.1.57699 WP_000006791.1.57785 WP_000006791.1.57800 WP_000006791.1.57873 WP_000006791.1.57965 WP_000006791.1.57972 WP_000006791.1.58008 WP_000006791.1.58044 WP_000006791.1.58081 WP_000006791.1.5809 WP_000006791.1.58132 WP_000006791.1.58173 WP_000006791.1.58191 WP_000006791.1.58194 WP_000006791.1.58252 WP_000006791.1.58261 WP_000006791.1.58274 WP_000006791.1.58282 WP_000006791.1.58324 WP_000006791.1.58326 WP_000006791.1.5836 WP_000006791.1.58485 WP_000006791.1.58537 WP_000006791.1.58568 WP_000006791.1.58583 WP_000006791.1.58652 WP_000006791.1.58663 WP_000006791.1.58724 WP_000006791.1.5875 WP_000006791.1.58796 WP_000006791.1.58807 WP_000006791.1.58847 WP_000006791.1.58883 WP_000006791.1.58898 WP_000006791.1.58949 WP_000006791.1.58963 WP_000006791.1.58970 WP_000006791.1.58974 WP_000006791.1.59020 WP_000006791.1.59043 WP_000006791.1.59056 WP_000006791.1.59061 WP_000006791.1.59064 WP_000006791.1.59282 WP_000006791.1.59299 WP_000006791.1.59313 WP_000006791.1.5949 WP_000006791.1.59501 WP_000006791.1.59510 WP_000006791.1.5969 WP_000006791.1.59751 WP_000006791.1.59827 WP_000006791.1.59829 WP_000006791.1.59847 WP_000006791.1.59863 WP_000006791.1.59969 WP_000006791.1.59994 WP_000006791.1.60045 WP_000006791.1.60076 WP_000006791.1.60114 WP_000006791.1.60154 WP_000006791.1.60168 WP_000006791.1.60192 WP_000006791.1.60199 WP_000006791.1.60212 WP_000006791.1.60253 WP_000006791.1.60322 WP_000006791.1.60324 WP_000006791.1.60356 WP_000006791.1.6038 WP_000006791.1.60380 WP_000006791.1.6041 WP_000006791.1.60424 WP_000006791.1.60481 WP_000006791.1.605 WP_000006791.1.6058 WP_000006791.1.60584 WP_000006791.1.6060 WP_000006791.1.60676 WP_000006791.1.60708 WP_000006791.1.60725 WP_000006791.1.60783 WP_000006791.1.60792 WP_000006791.1.60807 WP_000006791.1.60882 WP_000006791.1.60889 WP_000006791.1.60950 WP_000006791.1.6104 WP_000006791.1.61044 WP_000006791.1.61076 WP_000006791.1.61123 WP_000006791.1.61147 WP_000006791.1.61168 WP_000006791.1.61210 WP_000006791.1.61357 WP_000006791.1.61511 WP_000006791.1.61539 WP_000006791.1.61542 WP_000006791.1.61553 WP_000006791.1.61649 WP_000006791.1.61652 WP_000006791.1.61697 WP_000006791.1.61809 WP_000006791.1.61877 WP_000006791.1.61920 WP_000006791.1.62124 WP_000006791.1.62199 WP_000006791.1.62223 WP_000006791.1.62302 WP_000006791.1.62314 WP_000006791.1.62323 WP_000006791.1.62333 WP_000006791.1.62338 WP_000006791.1.62380 WP_000006791.1.62411 WP_000006791.1.62436 WP_000006791.1.62475 WP_000006791.1.62536 WP_000006791.1.62640 WP_000006791.1.62686 WP_000006791.1.62751 WP_000006791.1.62825 WP_000006791.1.62913 WP_000006791.1.62932 WP_000006791.1.62960 WP_000006791.1.63016 WP_000006791.1.63025 WP_000006791.1.63069 WP_000006791.1.63087 WP_000006791.1.63169 WP_000006791.1.63297 WP_000006791.1.63448 WP_000006791.1.63514 WP_000006791.1.63583 WP_000006791.1.63592 WP_000006791.1.63663 WP_000006791.1.63736 WP_000006791.1.63816 WP_000006791.1.63876 WP_000006791.1.6389 WP_000006791.1.63901 WP_000006791.1.63955 WP_000006791.1.63963 WP_000006791.1.64032 WP_000006791.1.64087 WP_000006791.1.6415 WP_000006791.1.64293 WP_000006791.1.64332 WP_000006791.1.64376 WP_000006791.1.64471 WP_000006791.1.64501 WP_000006791.1.64538 WP_000006791.1.64632 WP_000006791.1.64648 WP_000006791.1.64654 WP_000006791.1.64662 WP_000006791.1.64663 WP_000006791.1.64709 WP_000006791.1.64710 WP_000006791.1.64744 WP_000006791.1.64763 WP_000006791.1.64817 WP_000006791.1.64847 WP_000006791.1.6487 WP_000006791.1.64891 WP_000006791.1.64974 WP_000006791.1.65054 WP_000006791.1.65075 WP_000006791.1.6514 WP_000006791.1.65172 WP_000006791.1.65191 WP_000006791.1.65200 WP_000006791.1.65211 WP_000006791.1.65218 WP_000006791.1.65226 WP_000006791.1.65249 WP_000006791.1.65266 WP_000006791.1.65395 WP_000006791.1.65459 WP_000006791.1.65463 WP_000006791.1.65487 WP_000006791.1.6549 WP_000006791.1.65499 WP_000006791.1.6554 WP_000006791.1.65650 WP_000006791.1.65697 WP_000006791.1.65699 WP_000006791.1.65737 WP_000006791.1.65755 WP_000006791.1.65812 WP_000006791.1.65846 WP_000006791.1.65863 WP_000006791.1.65985 WP_000006791.1.66021 WP_000006791.1.66031 WP_000006791.1.66052 WP_000006791.1.66064 WP_000006791.1.66109 WP_000006791.1.66145 WP_000006791.1.66183 WP_000006791.1.6620 WP_000006791.1.66216 WP_000006791.1.66234 WP_000006791.1.66273 WP_000006791.1.66324 WP_000006791.1.6634 WP_000006791.1.66361 WP_000006791.1.66480 WP_000006791.1.66506 WP_000006791.1.66665 WP_000006791.1.66681 WP_000006791.1.66684 WP_000006791.1.66755 WP_000006791.1.66759 WP_000006791.1.66801 WP_000006791.1.66860 WP_000006791.1.66953 WP_000006791.1.66955 WP_000006791.1.66981 WP_000006791.1.67024 WP_000006791.1.67042 WP_000006791.1.67101 WP_000006791.1.67143 WP_000006791.1.67201 WP_000006791.1.67211 WP_000006791.1.67237 WP_000006791.1.67336 WP_000006791.1.67339 WP_000006791.1.67387 WP_000006791.1.67394 WP_000006791.1.67397 WP_000006791.1.67403 WP_000006791.1.67430 WP_000006791.1.67442 WP_000006791.1.67539 WP_000006791.1.67556 WP_000006791.1.67576 WP_000006791.1.67604 WP_000006791.1.67619 WP_000006791.1.67625 WP_000006791.1.67627 WP_000006791.1.67641 WP_000006791.1.67657 WP_000006791.1.67673 WP_000006791.1.67700 WP_000006791.1.67718 WP_000006791.1.67729 WP_000006791.1.67774 WP_000006791.1.67820 WP_000006791.1.67910 WP_000006791.1.67954 WP_000006791.1.68 WP_000006791.1.68043 WP_000006791.1.68105 WP_000006791.1.68113 WP_000006791.1.68131 WP_000006791.1.68182 WP_000006791.1.6819 WP_000006791.1.68285 WP_000006791.1.68359 WP_000006791.1.68420 WP_000006791.1.68514 WP_000006791.1.68564 WP_000006791.1.68688 WP_000006791.1.68742 WP_000006791.1.68770 WP_000006791.1.68809 WP_000006791.1.68914 WP_000006791.1.69170 WP_000006791.1.69210 WP_000006791.1.69270 WP_000006791.1.69282 WP_000006791.1.69376 WP_000006791.1.69396 WP_000006791.1.69466 WP_000006791.1.69611 WP_000006791.1.69642 WP_000006791.1.69656 WP_000006791.1.69657 WP_000006791.1.69690 WP_000006791.1.69923 WP_000006791.1.69948 WP_000006791.1.69953 WP_000006791.1.70049 WP_000006791.1.70058 WP_000006791.1.70061 WP_000006791.1.70205 WP_000006791.1.70240 WP_000006791.1.70249 WP_000006791.1.70261 WP_000006791.1.70314 WP_000006791.1.7033 WP_000006791.1.70427 WP_000006791.1.70433 WP_000006791.1.70545 WP_000006791.1.70623 WP_000006791.1.70671 WP_000006791.1.70679 WP_000006791.1.70708 WP_000006791.1.70717 WP_000006791.1.70731 WP_000006791.1.70772 WP_000006791.1.70845 WP_000006791.1.70846 WP_000006791.1.70981 WP_000006791.1.70995 WP_000006791.1.71039 WP_000006791.1.71057 WP_000006791.1.71081 WP_000006791.1.71117 WP_000006791.1.71186 WP_000006791.1.71455 WP_000006791.1.71456 WP_000006791.1.71487 WP_000006791.1.71523 WP_000006791.1.71542 WP_000006791.1.71566 WP_000006791.1.71640 WP_000006791.1.71651 WP_000006791.1.71653 WP_000006791.1.71716 WP_000006791.1.71872 WP_000006791.1.71950 WP_000006791.1.71954 WP_000006791.1.71985 WP_000006791.1.72003 WP_000006791.1.72073 WP_000006791.1.72269 WP_000006791.1.72350 WP_000006791.1.72383 WP_000006791.1.72461 WP_000006791.1.72527 WP_000006791.1.7255 WP_000006791.1.72631 WP_000006791.1.72638 WP_000006791.1.72674 WP_000006791.1.72724 WP_000006791.1.72789 WP_000006791.1.72828 WP_000006791.1.72896 WP_000006791.1.72969 WP_000006791.1.72987 WP_000006791.1.73052 WP_000006791.1.7311 WP_000006791.1.73114 WP_000006791.1.73177 WP_000006791.1.73180 WP_000006791.1.73258 WP_000006791.1.73285 WP_000006791.1.7332 WP_000006791.1.7333 WP_000006791.1.73352 WP_000006791.1.73425 WP_000006791.1.73488 WP_000006791.1.73504 WP_000006791.1.7353 WP_000006791.1.73544 WP_000006791.1.73598 WP_000006791.1.7361 WP_000006791.1.73648 WP_000006791.1.73768 WP_000006791.1.73849 WP_000006791.1.73948 WP_000006791.1.73999 WP_000006791.1.74024 WP_000006791.1.74030 WP_000006791.1.74038 WP_000006791.1.74043 WP_000006791.1.74058 WP_000006791.1.74070 WP_000006791.1.74077 WP_000006791.1.74135 WP_000006791.1.74214 WP_000006791.1.74241 WP_000006791.1.74285 WP_000006791.1.7430 WP_000006791.1.74317 WP_000006791.1.74415 WP_000006791.1.74616 WP_000006791.1.74621 WP_000006791.1.74647 WP_000006791.1.74677 WP_000006791.1.74699 WP_000006791.1.74831 WP_000006791.1.74894 WP_000006791.1.74929 WP_000006791.1.74939 WP_000006791.1.74973 WP_000006791.1.7507 WP_000006791.1.75089 WP_000006791.1.75116 WP_000006791.1.75237 WP_000006791.1.75273 WP_000006791.1.75296 WP_000006791.1.75413 WP_000006791.1.75433 WP_000006791.1.75532 WP_000006791.1.75565 WP_000006791.1.75593 WP_000006791.1.75610 WP_000006791.1.75633 WP_000006791.1.75718 WP_000006791.1.75745 WP_000006791.1.75844 WP_000006791.1.75886 WP_000006791.1.75898 WP_000006791.1.76081 WP_000006791.1.76116 WP_000006791.1.76122 WP_000006791.1.76256 WP_000006791.1.76339 WP_000006791.1.76366 WP_000006791.1.76417 WP_000006791.1.7646 WP_000006791.1.76510 WP_000006791.1.76558 WP_000006791.1.76572 WP_000006791.1.76641 WP_000006791.1.76651 WP_000006791.1.76653 WP_000006791.1.76788 WP_000006791.1.76854 WP_000006791.1.76916 WP_000006791.1.76932 WP_000006791.1.76973 WP_000006791.1.76988 WP_000006791.1.77016 WP_000006791.1.77087 WP_000006791.1.77090 WP_000006791.1.77111 WP_000006791.1.77299 WP_000006791.1.77384 WP_000006791.1.77512 WP_000006791.1.77513 WP_000006791.1.77563 WP_000006791.1.77702 WP_000006791.1.77713 WP_000006791.1.7772 WP_000006791.1.77825 WP_000006791.1.77837 WP_000006791.1.77900 WP_000006791.1.77923 WP_000006791.1.77975 WP_000006791.1.78035 WP_000006791.1.78048 WP_000006791.1.78107 WP_000006791.1.78166 WP_000006791.1.78192 WP_000006791.1.78195 WP_000006791.1.78291 WP_000006791.1.78309 WP_000006791.1.78320 WP_000006791.1.78382 WP_000006791.1.78388 WP_000006791.1.78410 WP_000006791.1.7862 WP_000006791.1.78626 WP_000006791.1.78661 WP_000006791.1.78674 WP_000006791.1.78676 WP_000006791.1.78761 WP_000006791.1.789 WP_000006791.1.78993 WP_000006791.1.79012 WP_000006791.1.79069 WP_000006791.1.79074 WP_000006791.1.79098 WP_000006791.1.79155 WP_000006791.1.79164 WP_000006791.1.79204 WP_000006791.1.79280 WP_000006791.1.79397 WP_000006791.1.79456 WP_000006791.1.79532 WP_000006791.1.79547 WP_000006791.1.79654 WP_000006791.1.7970 WP_000006791.1.79722 WP_000006791.1.79772 WP_000006791.1.79880 WP_000006791.1.79916 WP_000006791.1.80065 WP_000006791.1.80103 WP_000006791.1.80273 WP_000006791.1.80282 WP_000006791.1.80354 WP_000006791.1.80368 WP_000006791.1.80386 WP_000006791.1.80400 WP_000006791.1.80462 WP_000006791.1.8049 WP_000006791.1.80492 WP_000006791.1.80569 WP_000006791.1.80664 WP_000006791.1.80696 WP_000006791.1.81131 WP_000006791.1.81187 WP_000006791.1.81262 WP_000006791.1.81268 WP_000006791.1.81269 WP_000006791.1.81271 WP_000006791.1.8131 WP_000006791.1.81333 WP_000006791.1.81342 WP_000006791.1.81364 WP_000006791.1.81494 WP_000006791.1.81557 WP_000006791.1.81676 WP_000006791.1.81681 WP_000006791.1.8170 WP_000006791.1.81763 WP_000006791.1.81855 WP_000006791.1.81921 WP_000006791.1.81931 WP_000006791.1.81936 WP_000006791.1.81949 WP_000006791.1.82070 WP_000006791.1.82076 WP_000006791.1.82131 WP_000006791.1.82156 WP_000006791.1.8218 WP_000006791.1.82180 WP_000006791.1.82201 WP_000006791.1.82214 WP_000006791.1.82225 WP_000006791.1.8240 WP_000006791.1.82408 WP_000006791.1.82416 WP_000006791.1.8242 WP_000006791.1.82456 WP_000006791.1.82465 WP_000006791.1.82473 WP_000006791.1.82553 WP_000006791.1.82646 WP_000006791.1.82670 WP_000006791.1.82731 WP_000006791.1.82812 WP_000006791.1.82850 WP_000006791.1.82872 WP_000006791.1.8294 WP_000006791.1.82959 WP_000006791.1.83007 WP_000006791.1.8304 WP_000006791.1.83180 WP_000006791.1.83229 WP_000006791.1.83235 WP_000006791.1.83290 WP_000006791.1.83333 WP_000006791.1.83657 WP_000006791.1.83677 WP_000006791.1.8375 WP_000006791.1.83923 WP_000006791.1.83994 WP_000006791.1.84 WP_000006791.1.8406 WP_000006791.1.84076 WP_000006791.1.84110 WP_000006791.1.84127 WP_000006791.1.84150 WP_000006791.1.84230 WP_000006791.1.84252 WP_000006791.1.8431 WP_000006791.1.84345 WP_000006791.1.84369 WP_000006791.1.84401 WP_000006791.1.84435 WP_000006791.1.84567 WP_000006791.1.84631 WP_000006791.1.84727 WP_000006791.1.84744 WP_000006791.1.84773 WP_000006791.1.84945 WP_000006791.1.84967 WP_000006791.1.85004 WP_000006791.1.8502 WP_000006791.1.85039 WP_000006791.1.85153 WP_000006791.1.85273 WP_000006791.1.85338 WP_000006791.1.85339 WP_000006791.1.85511 WP_000006791.1.85512 WP_000006791.1.8557 WP_000006791.1.85606 WP_000006791.1.85635 WP_000006791.1.85646 WP_000006791.1.85665 WP_000006791.1.85669 WP_000006791.1.85688 WP_000006791.1.85703 WP_000006791.1.85728 WP_000006791.1.85746 WP_000006791.1.85811 WP_000006791.1.859 WP_000006791.1.85917 WP_000006791.1.8594 WP_000006791.1.85977 WP_000006791.1.860 WP_000006791.1.8605 WP_000006791.1.86084 WP_000006791.1.8610 WP_000006791.1.8614 WP_000006791.1.86156 WP_000006791.1.86323 WP_000006791.1.86342 WP_000006791.1.8640 WP_000006791.1.8642 WP_000006791.1.86426 WP_000006791.1.86489 WP_000006791.1.86530 WP_000006791.1.86663 WP_000006791.1.86770 WP_000006791.1.86794 WP_000006791.1.86800 WP_000006791.1.86811 WP_000006791.1.86815 WP_000006791.1.86945 WP_000006791.1.86989 WP_000006791.1.87023 WP_000006791.1.87034 WP_000006791.1.87041 WP_000006791.1.87136 WP_000006791.1.87155 WP_000006791.1.87258 WP_000006791.1.87293 WP_000006791.1.87420 WP_000006791.1.87528 WP_000006791.1.87560 WP_000006791.1.8760 WP_000006791.1.87600 WP_000006791.1.87609 WP_000006791.1.87615 WP_000006791.1.87653 WP_000006791.1.87659 WP_000006791.1.87698 WP_000006791.1.87706 WP_000006791.1.87739 WP_000006791.1.87741 WP_000006791.1.87742 WP_000006791.1.87852 WP_000006791.1.87949 WP_000006791.1.88025 WP_000006791.1.88026 WP_000006791.1.8805 WP_000006791.1.8806 WP_000006791.1.881 WP_000006791.1.88145 WP_000006791.1.88199 WP_000006791.1.88299 WP_000006791.1.88313 WP_000006791.1.88359 WP_000006791.1.88407 WP_000006791.1.88414 WP_000006791.1.88444 WP_000006791.1.88446 WP_000006791.1.88458 WP_000006791.1.88501 WP_000006791.1.88538 WP_000006791.1.88547 WP_000006791.1.886 WP_000006791.1.88647 WP_000006791.1.88648 WP_000006791.1.88692 WP_000006791.1.88707 WP_000006791.1.88727 WP_000006791.1.88772 WP_000006791.1.88850 WP_000006791.1.8889 WP_000006791.1.88892 WP_000006791.1.88894 WP_000006791.1.89182 WP_000006791.1.89298 WP_000006791.1.89308 WP_000006791.1.89314 WP_000006791.1.89328 WP_000006791.1.89332 WP_000006791.1.89343 WP_000006791.1.89395 WP_000006791.1.8940 WP_000006791.1.89449 WP_000006791.1.8947 WP_000006791.1.89591 WP_000006791.1.89612 WP_000006791.1.89668 WP_000006791.1.89706 WP_000006791.1.89713 WP_000006791.1.89733 WP_000006791.1.89796 WP_000006791.1.89804 WP_000006791.1.89845 WP_000006791.1.89888 WP_000006791.1.89911 WP_000006791.1.8995 WP_000006791.1.89952 WP_000006791.1.90007 WP_000006791.1.9011 WP_000006791.1.90196 WP_000006791.1.90240 WP_000006791.1.90274 WP_000006791.1.90280 WP_000006791.1.90330 WP_000006791.1.90338 WP_000006791.1.90365 WP_000006791.1.90428 WP_000006791.1.90489 WP_000006791.1.90513 WP_000006791.1.90582 WP_000006791.1.90713 WP_000006791.1.90794 WP_000006791.1.90796 WP_000006791.1.90811 WP_000006791.1.9091 WP_000006791.1.91067 WP_000006791.1.91164 WP_000006791.1.91205 WP_000006791.1.91239 WP_000006791.1.91291 WP_000006791.1.91313 WP_000006791.1.9135 WP_000006791.1.91506 WP_000006791.1.91557 WP_000006791.1.91597 WP_000006791.1.91715 WP_000006791.1.9187 WP_000006791.1.91870 WP_000006791.1.92018 WP_000006791.1.92087 WP_000006791.1.92098 WP_000006791.1.92156 WP_000006791.1.92172 WP_000006791.1.92240 WP_000006791.1.92243 WP_000006791.1.92327 WP_000006791.1.92470 WP_000006791.1.92477 WP_000006791.1.92545 WP_000006791.1.92570 WP_000006791.1.92588 WP_000006791.1.926 WP_000006791.1.92633 WP_000006791.1.92649 WP_000006791.1.92676 WP_000006791.1.92705 WP_000006791.1.9271 WP_000006791.1.92734 WP_000006791.1.92810 WP_000006791.1.92823 WP_000006791.1.92987 WP_000006791.1.93007 WP_000006791.1.93022 WP_000006791.1.93103 WP_000006791.1.93105 WP_000006791.1.93111 WP_000006791.1.93121 WP_000006791.1.93168 WP_000006791.1.93184 WP_000006791.1.93221 WP_000006791.1.93223 WP_000006791.1.93239 WP_000006791.1.93302 WP_000006791.1.9336 WP_000006791.1.93387 WP_000006791.1.93469 WP_000006791.1.93511 WP_000006791.1.93512 WP_000006791.1.93635 WP_000006791.1.93657 WP_000006791.1.9374 WP_000006791.1.9375 WP_000006791.1.93754 WP_000006791.1.93780 WP_000006791.1.93828 WP_000006791.1.93842 WP_000006791.1.93843 WP_000006791.1.93875 WP_000006791.1.93909 WP_000006791.1.93919 WP_000006791.1.93938 WP_000006791.1.93984 WP_000006791.1.9399 WP_000006791.1.94017 WP_000006791.1.94079 WP_000006791.1.94097 WP_000006791.1.94107 WP_000006791.1.94142 WP_000006791.1.94215 WP_000006791.1.94303 WP_000006791.1.94365 WP_000006791.1.94390 WP_000006791.1.94415 WP_000006791.1.94492 WP_000006791.1.94510 WP_000006791.1.94527 WP_000006791.1.94573 WP_000006791.1.94579 WP_000006791.1.94586 WP_000006791.1.94593 WP_000006791.1.94650 WP_000006791.1.94659 WP_000006791.1.94662 WP_000006791.1.94700 WP_000006791.1.94745 WP_000006791.1.94782 WP_000006791.1.94815 WP_000006791.1.94820 WP_000006791.1.94850 WP_000006791.1.94851 WP_000006791.1.94864 WP_000006791.1.94952 WP_000006791.1.95006 WP_000006791.1.95055 WP_000006791.1.95076 WP_000006791.1.95099 WP_000006791.1.95165 WP_000006791.1.95239 WP_000006791.1.95246 WP_000006791.1.9525 WP_000006791.1.95255 WP_000006791.1.95265 WP_000006791.1.95338 WP_000006791.1.95412 WP_000006791.1.95530 WP_000006791.1.95547 WP_000006791.1.95590 WP_000006791.1.95625 WP_000006791.1.95675 WP_000006791.1.95716 WP_000006791.1.95776 WP_000006791.1.95884 WP_000006791.1.95890 WP_000006791.1.95906 WP_000006791.1.96025 WP_000006791.1.96044 WP_000006791.1.96054 WP_000006791.1.96094 WP_000006791.1.96127 WP_000006791.1.96144 WP_000006791.1.96188 WP_000006791.1.96211 WP_000006791.1.96212 WP_000006791.1.9633 WP_000006791.1.96359 WP_000006791.1.96539 WP_000006791.1.96552 WP_000006791.1.96610 WP_000006791.1.96625 WP_000006791.1.96635 WP_000006791.1.9664 WP_000006791.1.96675 WP_000006791.1.9670 WP_000006791.1.96750 WP_000006791.1.96792 WP_000006791.1.96801 WP_000006791.1.96803 WP_000006791.1.96925 WP_000006791.1.96938 WP_000006791.1.96946 WP_000006791.1.96957 WP_000006791.1.96978 WP_000006791.1.97026 WP_000006791.1.97028 WP_000006791.1.97079 WP_000006791.1.97154 WP_000006791.1.97184 WP_000006791.1.97287 WP_000006791.1.97291 WP_000006791.1.97422 WP_000006791.1.97441 WP_000006791.1.97497 WP_000006791.1.97505 WP_000006791.1.97599 WP_000006791.1.97606 WP_000006791.1.97615 WP_000006791.1.97646 WP_000006791.1.97690 WP_000006791.1.97819 WP_000006791.1.97840 WP_000006791.1.97938 WP_000006791.1.97986 WP_000006791.1.98036 WP_000006791.1.98080 WP_000006791.1.98086 WP_000006791.1.98158 WP_000006791.1.98263 WP_000006791.1.98418 WP_000006791.1.98448 WP_000006791.1.98457 WP_000006791.1.9850 WP_000006791.1.98502 WP_000006791.1.98607 WP_000006791.1.98731 WP_000006791.1.98762 WP_000006791.1.9877 WP_000006791.1.98801 WP_000006791.1.98818 WP_000006791.1.99163 WP_000006791.1.99335 WP_000006791.1.99350 WP_000006791.1.99360 WP_000006791.1.99363 WP_000006791.1.99369 WP_000006791.1.99388 WP_000006791.1.99397 WP_000006791.1.99463 WP_000006791.1.99483 WP_000006791.1.99546 WP_000006791.1.99579 WP_000006791.1.99595 WP_000006791.1.99671 WP_000006791.1.99676 WP_000006791.1.99764 WP_000006791.1.99829 WP_000006791.1.99837 WP_000006791.1.99841 WP_000006791.1.9992 WP_000006791.1.99996 209261.t2441 220341.STY0461 gi|488654935|ref|YP_007926738.1| gi|378960611|ref|YP_005218097.1| gi|16759399|ref|NP_455016.1| gi|29142829|ref|NP_806171.1| AE014613|CDS_2512400-2514262 AL513382|CDS_468701-466839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]