SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488655463|ref|YP_007927266.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488655463|ref|YP_007927266.1|
Domain Number 1 Region: 5-330
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.7e-122
Family TK-like PP module 0.0000000000265
Further Details:      
 
Domain Number 2 Region: 336-526
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.44e-68
Family TK-like Pyr module 0.00000001
Further Details:      
 
Domain Number 3 Region: 533-663
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.7e-43
Family Transketolase C-terminal domain-like 0.000000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488655463|ref|YP_007927266.1|
Sequence length 663
Comment transketolase [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPTNPSWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPMSELQNFRQLHSKTPGHPEVGYTAGVETTTGPLGQGI
ANAVGMAIAEKTLAAQFNRPGHDIVDHFTYVFMGDGCMMEGISHEVCSLAGTLKLGKLIA
FYDDNGISIDGHVEGWFTDDTAKRFEAYGWHVIRGIDGHDADAIKRATEEARAVTDKPSL
LMCKTIIGFGSPNKQGTHDSHGAPLGDAEIALTREQLGWKYAPFEIPSEIYAQWDAKEAG
QAKESAWNEKFAAYEKAFPQEAAEFTRRMKGDMPADFNAKANEFIAKLQANPSKIASRKA
SQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKAINEDAAGNYIHYGVREFGMTAIANG
IALHGGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMVYTHDSIGLGEDGPTHQPVEQVA
SLRVTPNMSTWRPCDQVESAVAWKYGIERQDGPTALILSRQNLAQQERTEEQLANIARGG
YVLKDCAGQPQIIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQDAAYRESV
LPKAVSARVAIEAGIADYWFKYVGLNGAIVGMTTFGESAPAELLFEEFGFTVDNVIAKAK
ALL
Download sequence
Identical sequences WP_015606180.1.53154 gi|488655463|ref|YP_007927266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]