SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488655848|ref|YP_007927651.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488655848|ref|YP_007927651.1|
Domain Number 1 Region: 357-546
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.97e-65
Family Pyruvate oxidase and decarboxylase PP module 0.00000686
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.69e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000365
Further Details:      
 
Domain Number 3 Region: 181-342
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.46e-59
Family Pyruvate oxidase and decarboxylase, middle domain 0.000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488655848|ref|YP_007927651.1|
Sequence length 548
Comment acetolactate synthase 2 catalytic subunit [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MNGAQWVVHALRAQGVKTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMTAIGYARS
TGKTGVCIATSGPGATNLITGLADALLDSVPVVAITGQVSAPFIGTDAFQEVDVLGLSLA
CTKHSFLVQSLAELPRIMAEAFEVANAGRPGPVLVDIPKDIQLASGELEPWFTTVDNEAT
FPQADVEQARQMLEQAKKPMLYVGGGVGMAKAVPALRKFIAVTQMPVTCTLKGLGAVEAD
YPYYLGMLGMHGTKAANFAVQECDLLIAVGARFDDRVTGKLNTFAPNASVIHMDIDPAEM
NKLRQAHVALQGDLNSLLPALQQPLKIDAWRQSCAELRAEHAWRYDHPGETIYAPLLLKQ
LSERKPADSVVTTDVGQHQMWSAQHMTYTRPENFITSSGLGTMGFGLPAAVGAQVARPND
TVICISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRLGMVRQWQQLFFQERYSETTLTD
NPDFLMLASAFGIPGQHITRKDQVEAALDTMLASEGPYLLHVSIDELENVWPLVPPGASN
SEMLEKLS
Download sequence
Identical sequences WP_015606213.1.53154 gi|488655848|ref|YP_007927651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]