SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488656161|ref|YP_007927964.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488656161|ref|YP_007927964.1|
Domain Number 1 Region: 366-560
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.95e-64
Family Pyruvate oxidase and decarboxylase PP module 0.0000131
Further Details:      
 
Domain Number 2 Region: 10-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.44e-59
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000361
Further Details:      
 
Domain Number 3 Region: 165-359
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6.03e-57
Family Pyruvate oxidase and decarboxylase, middle domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488656161|ref|YP_007927964.1|
Sequence length 562
Comment acetolactate synthase catalytic subunit [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MASSGTTSTPQRFTGAEFIVHFLERQGIRIVTGIPGGSILPVYDALSQSTQIRHILARHE
QGAGFIAQGMARTESKPAVCMACSGPGATNLVTAIADARLDSIPLICITGQVPASMIGTD
AFQEVDTYGISIPITKHNYLVRNINELPQVMSDAFRLAQSGRPGPVWIDVPKDVQTATIE
LDALPSPAEKSPPPEFSAESIREAAAMINAAKRPVLYLGGGVINAPTRVRELAEKAQLPT
TMTLMALGMLPKAHPLSLGMLGMHGARSTNFILQEADLLIVLGARFDDRAIGKTEQFCPN
AKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQLIPHIEAQPREAWHQLVADLQQEFPCG
IPQENNPLSHYGLINAVAACVDDNAIITTDVGQHQMWTAQAYPLNRPRQWLTSGGLGTMG
FGLPAAIGAALANPGNKVLCFSGDGSLMMNIQEMATASENQLDVKIILMNNDALGLVHQQ
QSLFYKQGVFAATYPGSINFMQIAAGFGLDTCDLNNEADPQAALQAIIRRPGPALIHVRI
DAEEKVYPMVPPGAANTEMVGE
Download sequence
Identical sequences Q8Z2K9
gi|378961886|ref|YP_005219372.1| gi|488656161|ref|YP_007927964.1| 209261.t3722 220341.STY3986 gi|16762524|ref|NP_458141.1| gi|29144013|ref|NP_807355.1| NP_458141.1.84458 WP_000168445.1.100008 WP_000168445.1.100036 WP_000168445.1.100079 WP_000168445.1.100196 WP_000168445.1.100284 WP_000168445.1.100313 WP_000168445.1.100314 WP_000168445.1.100321 WP_000168445.1.100421 WP_000168445.1.100446 WP_000168445.1.100450 WP_000168445.1.100592 WP_000168445.1.100610 WP_000168445.1.100732 WP_000168445.1.100733 WP_000168445.1.100739 WP_000168445.1.100764 WP_000168445.1.100799 WP_000168445.1.100941 WP_000168445.1.100953 WP_000168445.1.101011 WP_000168445.1.10108 WP_000168445.1.101226 WP_000168445.1.10124 WP_000168445.1.101271 WP_000168445.1.101312 WP_000168445.1.101322 WP_000168445.1.101374 WP_000168445.1.101616 WP_000168445.1.101890 WP_000168445.1.101941 WP_000168445.1.102050 WP_000168445.1.102087 WP_000168445.1.10338 WP_000168445.1.1038 WP_000168445.1.104 WP_000168445.1.10401 WP_000168445.1.10428 WP_000168445.1.10459 WP_000168445.1.10475 WP_000168445.1.10514 WP_000168445.1.10530 WP_000168445.1.10547 WP_000168445.1.10595 WP_000168445.1.10642 WP_000168445.1.10654 WP_000168445.1.10677 WP_000168445.1.10857 WP_000168445.1.10873 WP_000168445.1.10926 WP_000168445.1.10936 WP_000168445.1.11012 WP_000168445.1.11126 WP_000168445.1.11142 WP_000168445.1.11239 WP_000168445.1.11314 WP_000168445.1.11385 WP_000168445.1.1142 WP_000168445.1.11426 WP_000168445.1.11429 WP_000168445.1.11638 WP_000168445.1.11883 WP_000168445.1.11908 WP_000168445.1.11914 WP_000168445.1.12061 WP_000168445.1.1207 WP_000168445.1.12141 WP_000168445.1.12192 WP_000168445.1.1224 WP_000168445.1.12364 WP_000168445.1.12398 WP_000168445.1.12441 WP_000168445.1.12648 WP_000168445.1.12683 WP_000168445.1.12726 WP_000168445.1.12727 WP_000168445.1.12741 WP_000168445.1.12834 WP_000168445.1.13108 WP_000168445.1.1321 WP_000168445.1.13268 WP_000168445.1.13291 WP_000168445.1.133 WP_000168445.1.13314 WP_000168445.1.13338 WP_000168445.1.13342 WP_000168445.1.13352 WP_000168445.1.13406 WP_000168445.1.13440 WP_000168445.1.13476 WP_000168445.1.13599 WP_000168445.1.13686 WP_000168445.1.1372 WP_000168445.1.13732 WP_000168445.1.1382 WP_000168445.1.1397 WP_000168445.1.13972 WP_000168445.1.140 WP_000168445.1.1401 WP_000168445.1.14089 WP_000168445.1.14099 WP_000168445.1.14123 WP_000168445.1.14150 WP_000168445.1.14191 WP_000168445.1.14280 WP_000168445.1.14333 WP_000168445.1.14399 WP_000168445.1.14444 WP_000168445.1.14467 WP_000168445.1.14474 WP_000168445.1.14500 WP_000168445.1.14526 WP_000168445.1.14550 WP_000168445.1.14575 WP_000168445.1.14701 WP_000168445.1.14703 WP_000168445.1.14719 WP_000168445.1.1473 WP_000168445.1.14765 WP_000168445.1.14810 WP_000168445.1.14877 WP_000168445.1.14930 WP_000168445.1.14947 WP_000168445.1.14948 WP_000168445.1.15184 WP_000168445.1.15244 WP_000168445.1.15265 WP_000168445.1.15362 WP_000168445.1.15423 WP_000168445.1.15433 WP_000168445.1.15487 WP_000168445.1.15535 WP_000168445.1.15581 WP_000168445.1.15597 WP_000168445.1.15710 WP_000168445.1.15717 WP_000168445.1.15905 WP_000168445.1.15912 WP_000168445.1.15970 WP_000168445.1.16046 WP_000168445.1.16051 WP_000168445.1.16150 WP_000168445.1.16155 WP_000168445.1.1626 WP_000168445.1.16264 WP_000168445.1.16452 WP_000168445.1.16461 WP_000168445.1.16462 WP_000168445.1.16465 WP_000168445.1.16522 WP_000168445.1.16588 WP_000168445.1.16658 WP_000168445.1.16666 WP_000168445.1.16673 WP_000168445.1.1674 WP_000168445.1.16767 WP_000168445.1.16781 WP_000168445.1.16879 WP_000168445.1.16893 WP_000168445.1.16905 WP_000168445.1.16948 WP_000168445.1.17049 WP_000168445.1.17058 WP_000168445.1.17078 WP_000168445.1.17202 WP_000168445.1.17219 WP_000168445.1.17302 WP_000168445.1.17308 WP_000168445.1.17368 WP_000168445.1.17405 WP_000168445.1.17406 WP_000168445.1.17513 WP_000168445.1.17543 WP_000168445.1.17563 WP_000168445.1.17578 WP_000168445.1.17659 WP_000168445.1.17667 WP_000168445.1.17686 WP_000168445.1.17741 WP_000168445.1.17840 WP_000168445.1.17956 WP_000168445.1.18005 WP_000168445.1.1801 WP_000168445.1.18021 WP_000168445.1.18099 WP_000168445.1.18124 WP_000168445.1.18144 WP_000168445.1.18173 WP_000168445.1.18270 WP_000168445.1.18280 WP_000168445.1.18328 WP_000168445.1.18358 WP_000168445.1.18370 WP_000168445.1.18406 WP_000168445.1.18474 WP_000168445.1.18513 WP_000168445.1.18610 WP_000168445.1.18678 WP_000168445.1.18722 WP_000168445.1.18766 WP_000168445.1.1880 WP_000168445.1.1885 WP_000168445.1.18860 WP_000168445.1.18922 WP_000168445.1.18959 WP_000168445.1.19001 WP_000168445.1.19006 WP_000168445.1.19044 WP_000168445.1.19084 WP_000168445.1.19187 WP_000168445.1.19228 WP_000168445.1.19288 WP_000168445.1.19300 WP_000168445.1.19422 WP_000168445.1.19454 WP_000168445.1.19456 WP_000168445.1.19496 WP_000168445.1.19535 WP_000168445.1.19538 WP_000168445.1.19589 WP_000168445.1.19663 WP_000168445.1.19686 WP_000168445.1.19731 WP_000168445.1.19794 WP_000168445.1.1992 WP_000168445.1.19999 WP_000168445.1.20254 WP_000168445.1.20255 WP_000168445.1.20296 WP_000168445.1.20339 WP_000168445.1.20419 WP_000168445.1.20465 WP_000168445.1.20492 WP_000168445.1.2053 WP_000168445.1.20635 WP_000168445.1.20718 WP_000168445.1.2073 WP_000168445.1.20740 WP_000168445.1.20828 WP_000168445.1.2087 WP_000168445.1.20883 WP_000168445.1.20947 WP_000168445.1.20953 WP_000168445.1.21010 WP_000168445.1.2106 WP_000168445.1.21062 WP_000168445.1.21144 WP_000168445.1.21162 WP_000168445.1.21184 WP_000168445.1.21185 WP_000168445.1.21492 WP_000168445.1.2166 WP_000168445.1.21674 WP_000168445.1.21946 WP_000168445.1.21966 WP_000168445.1.22064 WP_000168445.1.22118 WP_000168445.1.22126 WP_000168445.1.2216 WP_000168445.1.22208 WP_000168445.1.2227 WP_000168445.1.22373 WP_000168445.1.22476 WP_000168445.1.22614 WP_000168445.1.22652 WP_000168445.1.22683 WP_000168445.1.2284 WP_000168445.1.22895 WP_000168445.1.22926 WP_000168445.1.22943 WP_000168445.1.22967 WP_000168445.1.23040 WP_000168445.1.23058 WP_000168445.1.23218 WP_000168445.1.2331 WP_000168445.1.2332 WP_000168445.1.2336 WP_000168445.1.23365 WP_000168445.1.23412 WP_000168445.1.23426 WP_000168445.1.23492 WP_000168445.1.23515 WP_000168445.1.23548 WP_000168445.1.23604 WP_000168445.1.23679 WP_000168445.1.23728 WP_000168445.1.2375 WP_000168445.1.23783 WP_000168445.1.23786 WP_000168445.1.23787 WP_000168445.1.23801 WP_000168445.1.24028 WP_000168445.1.24061 WP_000168445.1.24083 WP_000168445.1.24117 WP_000168445.1.24125 WP_000168445.1.24138 WP_000168445.1.24153 WP_000168445.1.24291 WP_000168445.1.24322 WP_000168445.1.24355 WP_000168445.1.24375 WP_000168445.1.24400 WP_000168445.1.24619 WP_000168445.1.24643 WP_000168445.1.24688 WP_000168445.1.24716 WP_000168445.1.2481 WP_000168445.1.24832 WP_000168445.1.24964 WP_000168445.1.25017 WP_000168445.1.25032 WP_000168445.1.25041 WP_000168445.1.25053 WP_000168445.1.25140 WP_000168445.1.25185 WP_000168445.1.25196 WP_000168445.1.25210 WP_000168445.1.25219 WP_000168445.1.25304 WP_000168445.1.25374 WP_000168445.1.25490 WP_000168445.1.25508 WP_000168445.1.25512 WP_000168445.1.25603 WP_000168445.1.2562 WP_000168445.1.25666 WP_000168445.1.25807 WP_000168445.1.25821 WP_000168445.1.25833 WP_000168445.1.25835 WP_000168445.1.25882 WP_000168445.1.25911 WP_000168445.1.25962 WP_000168445.1.26001 WP_000168445.1.26027 WP_000168445.1.26107 WP_000168445.1.2615 WP_000168445.1.26217 WP_000168445.1.26230 WP_000168445.1.26232 WP_000168445.1.26272 WP_000168445.1.26286 WP_000168445.1.26394 WP_000168445.1.26491 WP_000168445.1.26554 WP_000168445.1.26636 WP_000168445.1.26689 WP_000168445.1.2679 WP_000168445.1.26908 WP_000168445.1.2692 WP_000168445.1.26928 WP_000168445.1.270 WP_000168445.1.27008 WP_000168445.1.27027 WP_000168445.1.27070 WP_000168445.1.27077 WP_000168445.1.27086 WP_000168445.1.27087 WP_000168445.1.27111 WP_000168445.1.27115 WP_000168445.1.2713 WP_000168445.1.2717 WP_000168445.1.27228 WP_000168445.1.27282 WP_000168445.1.27285 WP_000168445.1.27309 WP_000168445.1.27329 WP_000168445.1.27361 WP_000168445.1.27565 WP_000168445.1.27595 WP_000168445.1.27598 WP_000168445.1.27706 WP_000168445.1.27785 WP_000168445.1.27928 WP_000168445.1.27945 WP_000168445.1.28004 WP_000168445.1.2809 WP_000168445.1.28155 WP_000168445.1.28198 WP_000168445.1.28229 WP_000168445.1.28384 WP_000168445.1.28386 WP_000168445.1.28395 WP_000168445.1.284 WP_000168445.1.2845 WP_000168445.1.28627 WP_000168445.1.28692 WP_000168445.1.2873 WP_000168445.1.28917 WP_000168445.1.28962 WP_000168445.1.29023 WP_000168445.1.2905 WP_000168445.1.2907 WP_000168445.1.29081 WP_000168445.1.29089 WP_000168445.1.29153 WP_000168445.1.29203 WP_000168445.1.29237 WP_000168445.1.29248 WP_000168445.1.29288 WP_000168445.1.29389 WP_000168445.1.29439 WP_000168445.1.2946 WP_000168445.1.29462 WP_000168445.1.29563 WP_000168445.1.29743 WP_000168445.1.29782 WP_000168445.1.29833 WP_000168445.1.29851 WP_000168445.1.29865 WP_000168445.1.29886 WP_000168445.1.29919 WP_000168445.1.2994 WP_000168445.1.29964 WP_000168445.1.29983 WP_000168445.1.30009 WP_000168445.1.30013 WP_000168445.1.3002 WP_000168445.1.30034 WP_000168445.1.30049 WP_000168445.1.30058 WP_000168445.1.30172 WP_000168445.1.30185 WP_000168445.1.30354 WP_000168445.1.30357 WP_000168445.1.30362 WP_000168445.1.3042 WP_000168445.1.30421 WP_000168445.1.30440 WP_000168445.1.30448 WP_000168445.1.30517 WP_000168445.1.30542 WP_000168445.1.30544 WP_000168445.1.30556 WP_000168445.1.30572 WP_000168445.1.30585 WP_000168445.1.30618 WP_000168445.1.30664 WP_000168445.1.30688 WP_000168445.1.30806 WP_000168445.1.30967 WP_000168445.1.31046 WP_000168445.1.31066 WP_000168445.1.31139 WP_000168445.1.31145 WP_000168445.1.31182 WP_000168445.1.31205 WP_000168445.1.3121 WP_000168445.1.31223 WP_000168445.1.31303 WP_000168445.1.3131 WP_000168445.1.31352 WP_000168445.1.31389 WP_000168445.1.31413 WP_000168445.1.31446 WP_000168445.1.31533 WP_000168445.1.31799 WP_000168445.1.31836 WP_000168445.1.31951 WP_000168445.1.32041 WP_000168445.1.32042 WP_000168445.1.3207 WP_000168445.1.32189 WP_000168445.1.32202 WP_000168445.1.32263 WP_000168445.1.32293 WP_000168445.1.32299 WP_000168445.1.32422 WP_000168445.1.32425 WP_000168445.1.32460 WP_000168445.1.32529 WP_000168445.1.32578 WP_000168445.1.32617 WP_000168445.1.3270 WP_000168445.1.32725 WP_000168445.1.32848 WP_000168445.1.32868 WP_000168445.1.3290 WP_000168445.1.32940 WP_000168445.1.32941 WP_000168445.1.3296 WP_000168445.1.32966 WP_000168445.1.32985 WP_000168445.1.33037 WP_000168445.1.3305 WP_000168445.1.33051 WP_000168445.1.33065 WP_000168445.1.33122 WP_000168445.1.3315 WP_000168445.1.33208 WP_000168445.1.33214 WP_000168445.1.33247 WP_000168445.1.33280 WP_000168445.1.33283 WP_000168445.1.33313 WP_000168445.1.33339 WP_000168445.1.33382 WP_000168445.1.33490 WP_000168445.1.33501 WP_000168445.1.33529 WP_000168445.1.33689 WP_000168445.1.3370 WP_000168445.1.33730 WP_000168445.1.33741 WP_000168445.1.33840 WP_000168445.1.33926 WP_000168445.1.33957 WP_000168445.1.33969 WP_000168445.1.34001 WP_000168445.1.34059 WP_000168445.1.34118 WP_000168445.1.34211 WP_000168445.1.34214 WP_000168445.1.34234 WP_000168445.1.34284 WP_000168445.1.34376 WP_000168445.1.34382 WP_000168445.1.34484 WP_000168445.1.34517 WP_000168445.1.34530 WP_000168445.1.34665 WP_000168445.1.34694 WP_000168445.1.34751 WP_000168445.1.34824 WP_000168445.1.34834 WP_000168445.1.34932 WP_000168445.1.34962 WP_000168445.1.35001 WP_000168445.1.35040 WP_000168445.1.35074 WP_000168445.1.35175 WP_000168445.1.35240 WP_000168445.1.35274 WP_000168445.1.35532 WP_000168445.1.35560 WP_000168445.1.3557 WP_000168445.1.35628 WP_000168445.1.3570 WP_000168445.1.35712 WP_000168445.1.35713 WP_000168445.1.35736 WP_000168445.1.35791 WP_000168445.1.35795 WP_000168445.1.35870 WP_000168445.1.35916 WP_000168445.1.35938 WP_000168445.1.35966 WP_000168445.1.36000 WP_000168445.1.36034 WP_000168445.1.36036 WP_000168445.1.36069 WP_000168445.1.36291 WP_000168445.1.36298 WP_000168445.1.36308 WP_000168445.1.36323 WP_000168445.1.36343 WP_000168445.1.36460 WP_000168445.1.3649 WP_000168445.1.36495 WP_000168445.1.36526 WP_000168445.1.36579 WP_000168445.1.36617 WP_000168445.1.36618 WP_000168445.1.36643 WP_000168445.1.36663 WP_000168445.1.36701 WP_000168445.1.36725 WP_000168445.1.36779 WP_000168445.1.36802 WP_000168445.1.36821 WP_000168445.1.36853 WP_000168445.1.36950 WP_000168445.1.37014 WP_000168445.1.37133 WP_000168445.1.37176 WP_000168445.1.37199 WP_000168445.1.37200 WP_000168445.1.37258 WP_000168445.1.37303 WP_000168445.1.37513 WP_000168445.1.37584 WP_000168445.1.37590 WP_000168445.1.37593 WP_000168445.1.37600 WP_000168445.1.37613 WP_000168445.1.37659 WP_000168445.1.37662 WP_000168445.1.37675 WP_000168445.1.37691 WP_000168445.1.37761 WP_000168445.1.37775 WP_000168445.1.37777 WP_000168445.1.378 WP_000168445.1.379 WP_000168445.1.37911 WP_000168445.1.37941 WP_000168445.1.37985 WP_000168445.1.38061 WP_000168445.1.38064 WP_000168445.1.38108 WP_000168445.1.3816 WP_000168445.1.38207 WP_000168445.1.38261 WP_000168445.1.38266 WP_000168445.1.38310 WP_000168445.1.3834 WP_000168445.1.38351 WP_000168445.1.3838 WP_000168445.1.38381 WP_000168445.1.38440 WP_000168445.1.38486 WP_000168445.1.38515 WP_000168445.1.38595 WP_000168445.1.3860 WP_000168445.1.38642 WP_000168445.1.38734 WP_000168445.1.38877 WP_000168445.1.38983 WP_000168445.1.38996 WP_000168445.1.39056 WP_000168445.1.3914 WP_000168445.1.39147 WP_000168445.1.39161 WP_000168445.1.39210 WP_000168445.1.39235 WP_000168445.1.3931 WP_000168445.1.39435 WP_000168445.1.39502 WP_000168445.1.39530 WP_000168445.1.39619 WP_000168445.1.39620 WP_000168445.1.39624 WP_000168445.1.39659 WP_000168445.1.39667 WP_000168445.1.39879 WP_000168445.1.39890 WP_000168445.1.39941 WP_000168445.1.39945 WP_000168445.1.39947 WP_000168445.1.40095 WP_000168445.1.40097 WP_000168445.1.401 WP_000168445.1.40160 WP_000168445.1.40167 WP_000168445.1.40279 WP_000168445.1.40361 WP_000168445.1.4042 WP_000168445.1.40467 WP_000168445.1.40517 WP_000168445.1.40750 WP_000168445.1.40854 WP_000168445.1.4089 WP_000168445.1.40924 WP_000168445.1.40932 WP_000168445.1.40946 WP_000168445.1.41004 WP_000168445.1.4106 WP_000168445.1.41070 WP_000168445.1.41074 WP_000168445.1.41075 WP_000168445.1.41097 WP_000168445.1.41132 WP_000168445.1.41176 WP_000168445.1.41251 WP_000168445.1.41258 WP_000168445.1.41305 WP_000168445.1.41321 WP_000168445.1.41333 WP_000168445.1.41335 WP_000168445.1.4136 WP_000168445.1.41415 WP_000168445.1.41459 WP_000168445.1.41498 WP_000168445.1.41519 WP_000168445.1.41631 WP_000168445.1.41658 WP_000168445.1.41659 WP_000168445.1.41716 WP_000168445.1.41746 WP_000168445.1.41824 WP_000168445.1.41825 WP_000168445.1.41836 WP_000168445.1.41894 WP_000168445.1.41919 WP_000168445.1.41929 WP_000168445.1.4194 WP_000168445.1.42069 WP_000168445.1.42081 WP_000168445.1.42090 WP_000168445.1.42187 WP_000168445.1.42200 WP_000168445.1.42219 WP_000168445.1.42261 WP_000168445.1.42349 WP_000168445.1.42371 WP_000168445.1.42379 WP_000168445.1.42391 WP_000168445.1.42399 WP_000168445.1.42539 WP_000168445.1.42603 WP_000168445.1.42650 WP_000168445.1.4267 WP_000168445.1.42701 WP_000168445.1.42805 WP_000168445.1.42815 WP_000168445.1.42859 WP_000168445.1.4298 WP_000168445.1.43008 WP_000168445.1.43019 WP_000168445.1.43065 WP_000168445.1.43069 WP_000168445.1.43128 WP_000168445.1.43141 WP_000168445.1.43157 WP_000168445.1.43190 WP_000168445.1.43198 WP_000168445.1.4326 WP_000168445.1.43290 WP_000168445.1.43292 WP_000168445.1.43307 WP_000168445.1.43633 WP_000168445.1.43651 WP_000168445.1.43812 WP_000168445.1.43878 WP_000168445.1.43888 WP_000168445.1.43919 WP_000168445.1.44049 WP_000168445.1.44101 WP_000168445.1.44160 WP_000168445.1.44196 WP_000168445.1.44248 WP_000168445.1.44262 WP_000168445.1.44268 WP_000168445.1.4427 WP_000168445.1.44343 WP_000168445.1.44351 WP_000168445.1.44360 WP_000168445.1.44416 WP_000168445.1.44431 WP_000168445.1.44437 WP_000168445.1.44546 WP_000168445.1.4468 WP_000168445.1.44762 WP_000168445.1.44815 WP_000168445.1.44828 WP_000168445.1.44879 WP_000168445.1.4501 WP_000168445.1.45093 WP_000168445.1.45136 WP_000168445.1.45435 WP_000168445.1.45523 WP_000168445.1.45596 WP_000168445.1.45648 WP_000168445.1.45829 WP_000168445.1.45871 WP_000168445.1.46030 WP_000168445.1.46077 WP_000168445.1.46169 WP_000168445.1.46225 WP_000168445.1.46241 WP_000168445.1.46307 WP_000168445.1.46355 WP_000168445.1.464 WP_000168445.1.46461 WP_000168445.1.46504 WP_000168445.1.46505 WP_000168445.1.46551 WP_000168445.1.46701 WP_000168445.1.46781 WP_000168445.1.46816 WP_000168445.1.46842 WP_000168445.1.4690 WP_000168445.1.46920 WP_000168445.1.46945 WP_000168445.1.47036 WP_000168445.1.47037 WP_000168445.1.47042 WP_000168445.1.47059 WP_000168445.1.47085 WP_000168445.1.47123 WP_000168445.1.47215 WP_000168445.1.47245 WP_000168445.1.47523 WP_000168445.1.47532 WP_000168445.1.47605 WP_000168445.1.47630 WP_000168445.1.4774 WP_000168445.1.47756 WP_000168445.1.4781 WP_000168445.1.47886 WP_000168445.1.47898 WP_000168445.1.48019 WP_000168445.1.48100 WP_000168445.1.48114 WP_000168445.1.48139 WP_000168445.1.48190 WP_000168445.1.48292 WP_000168445.1.48324 WP_000168445.1.48426 WP_000168445.1.48430 WP_000168445.1.48436 WP_000168445.1.48586 WP_000168445.1.48591 WP_000168445.1.48631 WP_000168445.1.48663 WP_000168445.1.48690 WP_000168445.1.48734 WP_000168445.1.48756 WP_000168445.1.48778 WP_000168445.1.48849 WP_000168445.1.48955 WP_000168445.1.48963 WP_000168445.1.49004 WP_000168445.1.49106 WP_000168445.1.49117 WP_000168445.1.49121 WP_000168445.1.4914 WP_000168445.1.49140 WP_000168445.1.49153 WP_000168445.1.49166 WP_000168445.1.49355 WP_000168445.1.49429 WP_000168445.1.49450 WP_000168445.1.495 WP_000168445.1.49545 WP_000168445.1.49703 WP_000168445.1.49769 WP_000168445.1.49846 WP_000168445.1.4991 WP_000168445.1.49947 WP_000168445.1.49959 WP_000168445.1.49997 WP_000168445.1.50014 WP_000168445.1.50030 WP_000168445.1.50043 WP_000168445.1.50103 WP_000168445.1.50158 WP_000168445.1.50247 WP_000168445.1.50308 WP_000168445.1.50309 WP_000168445.1.50387 WP_000168445.1.50406 WP_000168445.1.50468 WP_000168445.1.5051 WP_000168445.1.50566 WP_000168445.1.50570 WP_000168445.1.50626 WP_000168445.1.50771 WP_000168445.1.50875 WP_000168445.1.50885 WP_000168445.1.509 WP_000168445.1.50929 WP_000168445.1.50970 WP_000168445.1.51040 WP_000168445.1.51048 WP_000168445.1.51100 WP_000168445.1.51134 WP_000168445.1.51227 WP_000168445.1.5127 WP_000168445.1.51305 WP_000168445.1.51315 WP_000168445.1.5136 WP_000168445.1.51474 WP_000168445.1.51519 WP_000168445.1.51598 WP_000168445.1.51644 WP_000168445.1.51724 WP_000168445.1.51734 WP_000168445.1.51838 WP_000168445.1.51863 WP_000168445.1.51935 WP_000168445.1.52057 WP_000168445.1.52114 WP_000168445.1.52202 WP_000168445.1.52209 WP_000168445.1.52339 WP_000168445.1.52469 WP_000168445.1.52571 WP_000168445.1.526 WP_000168445.1.52647 WP_000168445.1.52742 WP_000168445.1.52773 WP_000168445.1.52795 WP_000168445.1.52807 WP_000168445.1.52887 WP_000168445.1.53092 WP_000168445.1.53141 WP_000168445.1.53151 WP_000168445.1.53154 WP_000168445.1.53159 WP_000168445.1.53210 WP_000168445.1.53321 WP_000168445.1.53368 WP_000168445.1.53375 WP_000168445.1.53450 WP_000168445.1.5349 WP_000168445.1.53540 WP_000168445.1.53555 WP_000168445.1.53559 WP_000168445.1.5356 WP_000168445.1.53571 WP_000168445.1.5358 WP_000168445.1.53692 WP_000168445.1.5374 WP_000168445.1.53750 WP_000168445.1.53800 WP_000168445.1.53815 WP_000168445.1.53839 WP_000168445.1.53892 WP_000168445.1.53898 WP_000168445.1.53902 WP_000168445.1.53958 WP_000168445.1.53981 WP_000168445.1.53984 WP_000168445.1.54132 WP_000168445.1.54170 WP_000168445.1.54175 WP_000168445.1.54203 WP_000168445.1.54259 WP_000168445.1.5430 WP_000168445.1.54371 WP_000168445.1.54431 WP_000168445.1.54442 WP_000168445.1.54482 WP_000168445.1.54589 WP_000168445.1.54667 WP_000168445.1.54678 WP_000168445.1.54681 WP_000168445.1.54748 WP_000168445.1.5481 WP_000168445.1.54935 WP_000168445.1.54979 WP_000168445.1.55010 WP_000168445.1.55034 WP_000168445.1.55163 WP_000168445.1.55165 WP_000168445.1.55215 WP_000168445.1.55290 WP_000168445.1.55310 WP_000168445.1.55317 WP_000168445.1.55379 WP_000168445.1.5539 WP_000168445.1.55468 WP_000168445.1.55506 WP_000168445.1.55604 WP_000168445.1.55639 WP_000168445.1.55699 WP_000168445.1.55780 WP_000168445.1.55967 WP_000168445.1.56144 WP_000168445.1.56172 WP_000168445.1.5621 WP_000168445.1.56226 WP_000168445.1.56311 WP_000168445.1.56419 WP_000168445.1.56423 WP_000168445.1.56514 WP_000168445.1.56535 WP_000168445.1.56585 WP_000168445.1.56724 WP_000168445.1.56825 WP_000168445.1.56887 WP_000168445.1.56889 WP_000168445.1.57101 WP_000168445.1.57137 WP_000168445.1.57147 WP_000168445.1.57186 WP_000168445.1.57342 WP_000168445.1.57684 WP_000168445.1.57699 WP_000168445.1.57785 WP_000168445.1.57800 WP_000168445.1.57873 WP_000168445.1.57965 WP_000168445.1.57972 WP_000168445.1.58008 WP_000168445.1.58044 WP_000168445.1.58081 WP_000168445.1.5809 WP_000168445.1.58132 WP_000168445.1.58173 WP_000168445.1.58191 WP_000168445.1.58194 WP_000168445.1.58252 WP_000168445.1.58261 WP_000168445.1.58274 WP_000168445.1.58282 WP_000168445.1.58324 WP_000168445.1.58326 WP_000168445.1.5836 WP_000168445.1.58485 WP_000168445.1.58537 WP_000168445.1.58568 WP_000168445.1.58652 WP_000168445.1.58663 WP_000168445.1.58724 WP_000168445.1.5875 WP_000168445.1.58796 WP_000168445.1.58807 WP_000168445.1.58847 WP_000168445.1.58883 WP_000168445.1.58898 WP_000168445.1.58949 WP_000168445.1.58963 WP_000168445.1.58970 WP_000168445.1.58974 WP_000168445.1.59020 WP_000168445.1.59043 WP_000168445.1.59056 WP_000168445.1.59061 WP_000168445.1.59064 WP_000168445.1.59299 WP_000168445.1.59313 WP_000168445.1.5949 WP_000168445.1.59501 WP_000168445.1.59510 WP_000168445.1.5969 WP_000168445.1.59751 WP_000168445.1.59827 WP_000168445.1.59829 WP_000168445.1.59847 WP_000168445.1.59863 WP_000168445.1.59969 WP_000168445.1.59994 WP_000168445.1.60045 WP_000168445.1.60076 WP_000168445.1.60114 WP_000168445.1.60154 WP_000168445.1.60168 WP_000168445.1.60192 WP_000168445.1.60199 WP_000168445.1.60212 WP_000168445.1.60253 WP_000168445.1.60322 WP_000168445.1.60324 WP_000168445.1.60356 WP_000168445.1.6038 WP_000168445.1.60380 WP_000168445.1.6041 WP_000168445.1.60424 WP_000168445.1.60481 WP_000168445.1.605 WP_000168445.1.6058 WP_000168445.1.6060 WP_000168445.1.60676 WP_000168445.1.60708 WP_000168445.1.60725 WP_000168445.1.60783 WP_000168445.1.60792 WP_000168445.1.60807 WP_000168445.1.60882 WP_000168445.1.60889 WP_000168445.1.60950 WP_000168445.1.6104 WP_000168445.1.61044 WP_000168445.1.61076 WP_000168445.1.61123 WP_000168445.1.61147 WP_000168445.1.61168 WP_000168445.1.61210 WP_000168445.1.61357 WP_000168445.1.61511 WP_000168445.1.61542 WP_000168445.1.61553 WP_000168445.1.61649 WP_000168445.1.61652 WP_000168445.1.61697 WP_000168445.1.61809 WP_000168445.1.61877 WP_000168445.1.61920 WP_000168445.1.62124 WP_000168445.1.62199 WP_000168445.1.62314 WP_000168445.1.62323 WP_000168445.1.62338 WP_000168445.1.62380 WP_000168445.1.62411 WP_000168445.1.62436 WP_000168445.1.62475 WP_000168445.1.62536 WP_000168445.1.62640 WP_000168445.1.62751 WP_000168445.1.62825 WP_000168445.1.62913 WP_000168445.1.62932 WP_000168445.1.62960 WP_000168445.1.63016 WP_000168445.1.63025 WP_000168445.1.63069 WP_000168445.1.63087 WP_000168445.1.63169 WP_000168445.1.63297 WP_000168445.1.63448 WP_000168445.1.63514 WP_000168445.1.63592 WP_000168445.1.63663 WP_000168445.1.63736 WP_000168445.1.63816 WP_000168445.1.6389 WP_000168445.1.63955 WP_000168445.1.63963 WP_000168445.1.64032 WP_000168445.1.64087 WP_000168445.1.6415 WP_000168445.1.64293 WP_000168445.1.64332 WP_000168445.1.64376 WP_000168445.1.644 WP_000168445.1.64471 WP_000168445.1.64538 WP_000168445.1.64632 WP_000168445.1.64648 WP_000168445.1.64654 WP_000168445.1.64662 WP_000168445.1.64663 WP_000168445.1.64709 WP_000168445.1.64710 WP_000168445.1.64744 WP_000168445.1.64763 WP_000168445.1.64817 WP_000168445.1.64847 WP_000168445.1.6487 WP_000168445.1.64891 WP_000168445.1.64974 WP_000168445.1.65054 WP_000168445.1.65075 WP_000168445.1.6514 WP_000168445.1.65172 WP_000168445.1.65191 WP_000168445.1.65200 WP_000168445.1.65211 WP_000168445.1.65218 WP_000168445.1.65226 WP_000168445.1.65249 WP_000168445.1.65266 WP_000168445.1.65395 WP_000168445.1.65459 WP_000168445.1.65463 WP_000168445.1.65487 WP_000168445.1.6549 WP_000168445.1.65499 WP_000168445.1.6554 WP_000168445.1.65650 WP_000168445.1.65697 WP_000168445.1.65699 WP_000168445.1.65755 WP_000168445.1.65812 WP_000168445.1.65846 WP_000168445.1.65863 WP_000168445.1.65985 WP_000168445.1.66021 WP_000168445.1.66031 WP_000168445.1.66052 WP_000168445.1.66064 WP_000168445.1.66109 WP_000168445.1.66145 WP_000168445.1.66183 WP_000168445.1.6620 WP_000168445.1.66216 WP_000168445.1.66234 WP_000168445.1.66273 WP_000168445.1.66324 WP_000168445.1.6634 WP_000168445.1.66480 WP_000168445.1.66506 WP_000168445.1.66665 WP_000168445.1.66681 WP_000168445.1.66684 WP_000168445.1.66755 WP_000168445.1.66860 WP_000168445.1.66953 WP_000168445.1.66955 WP_000168445.1.66981 WP_000168445.1.67024 WP_000168445.1.67042 WP_000168445.1.67101 WP_000168445.1.67143 WP_000168445.1.67201 WP_000168445.1.67211 WP_000168445.1.67237 WP_000168445.1.67336 WP_000168445.1.67339 WP_000168445.1.67387 WP_000168445.1.67394 WP_000168445.1.67397 WP_000168445.1.67403 WP_000168445.1.67430 WP_000168445.1.67442 WP_000168445.1.67556 WP_000168445.1.67576 WP_000168445.1.67604 WP_000168445.1.67619 WP_000168445.1.67625 WP_000168445.1.67627 WP_000168445.1.67641 WP_000168445.1.67657 WP_000168445.1.67673 WP_000168445.1.67700 WP_000168445.1.67718 WP_000168445.1.67729 WP_000168445.1.67774 WP_000168445.1.67820 WP_000168445.1.67954 WP_000168445.1.68 WP_000168445.1.68043 WP_000168445.1.68105 WP_000168445.1.68113 WP_000168445.1.68131 WP_000168445.1.68182 WP_000168445.1.6819 WP_000168445.1.68285 WP_000168445.1.68359 WP_000168445.1.68514 WP_000168445.1.68564 WP_000168445.1.68688 WP_000168445.1.68742 WP_000168445.1.68770 WP_000168445.1.68809 WP_000168445.1.68914 WP_000168445.1.69053 WP_000168445.1.69170 WP_000168445.1.69210 WP_000168445.1.69270 WP_000168445.1.69282 WP_000168445.1.69376 WP_000168445.1.69396 WP_000168445.1.69466 WP_000168445.1.69611 WP_000168445.1.69642 WP_000168445.1.69656 WP_000168445.1.69657 WP_000168445.1.69690 WP_000168445.1.69923 WP_000168445.1.69948 WP_000168445.1.69953 WP_000168445.1.70010 WP_000168445.1.70058 WP_000168445.1.70061 WP_000168445.1.70240 WP_000168445.1.70249 WP_000168445.1.70314 WP_000168445.1.7033 WP_000168445.1.70427 WP_000168445.1.70433 WP_000168445.1.70545 WP_000168445.1.70623 WP_000168445.1.70708 WP_000168445.1.70717 WP_000168445.1.70731 WP_000168445.1.70772 WP_000168445.1.70845 WP_000168445.1.70846 WP_000168445.1.70981 WP_000168445.1.70995 WP_000168445.1.71039 WP_000168445.1.71057 WP_000168445.1.71081 WP_000168445.1.71117 WP_000168445.1.71186 WP_000168445.1.71455 WP_000168445.1.71456 WP_000168445.1.71487 WP_000168445.1.71523 WP_000168445.1.71542 WP_000168445.1.71566 WP_000168445.1.71640 WP_000168445.1.71651 WP_000168445.1.71653 WP_000168445.1.71716 WP_000168445.1.71872 WP_000168445.1.71950 WP_000168445.1.71954 WP_000168445.1.71985 WP_000168445.1.72003 WP_000168445.1.72073 WP_000168445.1.72269 WP_000168445.1.72350 WP_000168445.1.72383 WP_000168445.1.72461 WP_000168445.1.72527 WP_000168445.1.7255 WP_000168445.1.72631 WP_000168445.1.72667 WP_000168445.1.72674 WP_000168445.1.72724 WP_000168445.1.72789 WP_000168445.1.72896 WP_000168445.1.72969 WP_000168445.1.72987 WP_000168445.1.73052 WP_000168445.1.7311 WP_000168445.1.73114 WP_000168445.1.73177 WP_000168445.1.73180 WP_000168445.1.73258 WP_000168445.1.73285 WP_000168445.1.7332 WP_000168445.1.7333 WP_000168445.1.73352 WP_000168445.1.73389 WP_000168445.1.73425 WP_000168445.1.73488 WP_000168445.1.73504 WP_000168445.1.7353 WP_000168445.1.73544 WP_000168445.1.73598 WP_000168445.1.7361 WP_000168445.1.73648 WP_000168445.1.73768 WP_000168445.1.73849 WP_000168445.1.73948 WP_000168445.1.73999 WP_000168445.1.74030 WP_000168445.1.74038 WP_000168445.1.74043 WP_000168445.1.74058 WP_000168445.1.74070 WP_000168445.1.74077 WP_000168445.1.74135 WP_000168445.1.74214 WP_000168445.1.74285 WP_000168445.1.7430 WP_000168445.1.74317 WP_000168445.1.74415 WP_000168445.1.74616 WP_000168445.1.74621 WP_000168445.1.74647 WP_000168445.1.74677 WP_000168445.1.74699 WP_000168445.1.74831 WP_000168445.1.74894 WP_000168445.1.74939 WP_000168445.1.74973 WP_000168445.1.7507 WP_000168445.1.75089 WP_000168445.1.75116 WP_000168445.1.75273 WP_000168445.1.75296 WP_000168445.1.75413 WP_000168445.1.75433 WP_000168445.1.75532 WP_000168445.1.75565 WP_000168445.1.75593 WP_000168445.1.75610 WP_000168445.1.75633 WP_000168445.1.75718 WP_000168445.1.75745 WP_000168445.1.75844 WP_000168445.1.75886 WP_000168445.1.75898 WP_000168445.1.76081 WP_000168445.1.76116 WP_000168445.1.76256 WP_000168445.1.76339 WP_000168445.1.76366 WP_000168445.1.76417 WP_000168445.1.7646 WP_000168445.1.76510 WP_000168445.1.76558 WP_000168445.1.76572 WP_000168445.1.76641 WP_000168445.1.76651 WP_000168445.1.76653 WP_000168445.1.76788 WP_000168445.1.76854 WP_000168445.1.76916 WP_000168445.1.76932 WP_000168445.1.76973 WP_000168445.1.76988 WP_000168445.1.77016 WP_000168445.1.77087 WP_000168445.1.77090 WP_000168445.1.77111 WP_000168445.1.77299 WP_000168445.1.77384 WP_000168445.1.77501 WP_000168445.1.77512 WP_000168445.1.77513 WP_000168445.1.77563 WP_000168445.1.77702 WP_000168445.1.77713 WP_000168445.1.7772 WP_000168445.1.77825 WP_000168445.1.77837 WP_000168445.1.77900 WP_000168445.1.77923 WP_000168445.1.77975 WP_000168445.1.78035 WP_000168445.1.78048 WP_000168445.1.78107 WP_000168445.1.78166 WP_000168445.1.78192 WP_000168445.1.78195 WP_000168445.1.78291 WP_000168445.1.78309 WP_000168445.1.78320 WP_000168445.1.78382 WP_000168445.1.78388 WP_000168445.1.78410 WP_000168445.1.7862 WP_000168445.1.78626 WP_000168445.1.78661 WP_000168445.1.78674 WP_000168445.1.78676 WP_000168445.1.78761 WP_000168445.1.789 WP_000168445.1.78993 WP_000168445.1.79012 WP_000168445.1.79069 WP_000168445.1.79074 WP_000168445.1.79098 WP_000168445.1.79155 WP_000168445.1.79164 WP_000168445.1.79204 WP_000168445.1.79280 WP_000168445.1.79397 WP_000168445.1.79456 WP_000168445.1.79532 WP_000168445.1.79547 WP_000168445.1.79654 WP_000168445.1.79722 WP_000168445.1.79772 WP_000168445.1.79880 WP_000168445.1.79916 WP_000168445.1.80065 WP_000168445.1.80103 WP_000168445.1.80354 WP_000168445.1.80368 WP_000168445.1.80386 WP_000168445.1.80462 WP_000168445.1.8049 WP_000168445.1.80492 WP_000168445.1.80569 WP_000168445.1.80664 WP_000168445.1.80984 WP_000168445.1.81131 WP_000168445.1.81187 WP_000168445.1.81262 WP_000168445.1.81268 WP_000168445.1.81269 WP_000168445.1.81271 WP_000168445.1.8131 WP_000168445.1.81333 WP_000168445.1.81342 WP_000168445.1.81364 WP_000168445.1.81494 WP_000168445.1.81557 WP_000168445.1.81676 WP_000168445.1.81681 WP_000168445.1.8170 WP_000168445.1.81763 WP_000168445.1.81855 WP_000168445.1.81921 WP_000168445.1.81931 WP_000168445.1.81936 WP_000168445.1.81949 WP_000168445.1.82076 WP_000168445.1.82156 WP_000168445.1.8218 WP_000168445.1.82201 WP_000168445.1.82214 WP_000168445.1.82225 WP_000168445.1.8240 WP_000168445.1.82408 WP_000168445.1.82416 WP_000168445.1.8242 WP_000168445.1.82456 WP_000168445.1.82465 WP_000168445.1.82473 WP_000168445.1.82553 WP_000168445.1.82646 WP_000168445.1.82670 WP_000168445.1.82812 WP_000168445.1.82850 WP_000168445.1.82872 WP_000168445.1.8294 WP_000168445.1.82959 WP_000168445.1.83007 WP_000168445.1.8304 WP_000168445.1.83229 WP_000168445.1.83235 WP_000168445.1.83290 WP_000168445.1.83677 WP_000168445.1.8375 WP_000168445.1.83923 WP_000168445.1.83994 WP_000168445.1.84 WP_000168445.1.8406 WP_000168445.1.84076 WP_000168445.1.84127 WP_000168445.1.84150 WP_000168445.1.84230 WP_000168445.1.84252 WP_000168445.1.8431 WP_000168445.1.84345 WP_000168445.1.84369 WP_000168445.1.84401 WP_000168445.1.84567 WP_000168445.1.84631 WP_000168445.1.84727 WP_000168445.1.84744 WP_000168445.1.84773 WP_000168445.1.84945 WP_000168445.1.84967 WP_000168445.1.85004 WP_000168445.1.8502 WP_000168445.1.85039 WP_000168445.1.85273 WP_000168445.1.85339 WP_000168445.1.85511 WP_000168445.1.85512 WP_000168445.1.8557 WP_000168445.1.85606 WP_000168445.1.85635 WP_000168445.1.85646 WP_000168445.1.85665 WP_000168445.1.85669 WP_000168445.1.85688 WP_000168445.1.85728 WP_000168445.1.85746 WP_000168445.1.85811 WP_000168445.1.859 WP_000168445.1.85917 WP_000168445.1.8594 WP_000168445.1.85977 WP_000168445.1.860 WP_000168445.1.8605 WP_000168445.1.86084 WP_000168445.1.8610 WP_000168445.1.8614 WP_000168445.1.86156 WP_000168445.1.86323 WP_000168445.1.86342 WP_000168445.1.8640 WP_000168445.1.8642 WP_000168445.1.86426 WP_000168445.1.86489 WP_000168445.1.86530 WP_000168445.1.86663 WP_000168445.1.86770 WP_000168445.1.86794 WP_000168445.1.86800 WP_000168445.1.86811 WP_000168445.1.86815 WP_000168445.1.87023 WP_000168445.1.87034 WP_000168445.1.87041 WP_000168445.1.87155 WP_000168445.1.87258 WP_000168445.1.87420 WP_000168445.1.87528 WP_000168445.1.87560 WP_000168445.1.8760 WP_000168445.1.87600 WP_000168445.1.87609 WP_000168445.1.87612 WP_000168445.1.87615 WP_000168445.1.87653 WP_000168445.1.87659 WP_000168445.1.87698 WP_000168445.1.87706 WP_000168445.1.87739 WP_000168445.1.87741 WP_000168445.1.87742 WP_000168445.1.87852 WP_000168445.1.87949 WP_000168445.1.88025 WP_000168445.1.8805 WP_000168445.1.8806 WP_000168445.1.881 WP_000168445.1.88145 WP_000168445.1.88199 WP_000168445.1.88299 WP_000168445.1.88313 WP_000168445.1.88359 WP_000168445.1.88407 WP_000168445.1.88414 WP_000168445.1.88444 WP_000168445.1.88446 WP_000168445.1.88458 WP_000168445.1.88501 WP_000168445.1.88538 WP_000168445.1.88547 WP_000168445.1.886 WP_000168445.1.88647 WP_000168445.1.88648 WP_000168445.1.88692 WP_000168445.1.88707 WP_000168445.1.88772 WP_000168445.1.88850 WP_000168445.1.8889 WP_000168445.1.88892 WP_000168445.1.88894 WP_000168445.1.89182 WP_000168445.1.89298 WP_000168445.1.89308 WP_000168445.1.89314 WP_000168445.1.89328 WP_000168445.1.89343 WP_000168445.1.89395 WP_000168445.1.89449 WP_000168445.1.8947 WP_000168445.1.89503 WP_000168445.1.89591 WP_000168445.1.89612 WP_000168445.1.89668 WP_000168445.1.89706 WP_000168445.1.89713 WP_000168445.1.89733 WP_000168445.1.89796 WP_000168445.1.89804 WP_000168445.1.89845 WP_000168445.1.89888 WP_000168445.1.89911 WP_000168445.1.8995 WP_000168445.1.89952 WP_000168445.1.9011 WP_000168445.1.90196 WP_000168445.1.90274 WP_000168445.1.90280 WP_000168445.1.90330 WP_000168445.1.90338 WP_000168445.1.90365 WP_000168445.1.90428 WP_000168445.1.90489 WP_000168445.1.90513 WP_000168445.1.90582 WP_000168445.1.90713 WP_000168445.1.90794 WP_000168445.1.90796 WP_000168445.1.90811 WP_000168445.1.9091 WP_000168445.1.91067 WP_000168445.1.91205 WP_000168445.1.91239 WP_000168445.1.91291 WP_000168445.1.91313 WP_000168445.1.9135 WP_000168445.1.91506 WP_000168445.1.91557 WP_000168445.1.91597 WP_000168445.1.91715 WP_000168445.1.91870 WP_000168445.1.92018 WP_000168445.1.92087 WP_000168445.1.92098 WP_000168445.1.92156 WP_000168445.1.92172 WP_000168445.1.92240 WP_000168445.1.92243 WP_000168445.1.92327 WP_000168445.1.92470 WP_000168445.1.92477 WP_000168445.1.92545 WP_000168445.1.92570 WP_000168445.1.92588 WP_000168445.1.926 WP_000168445.1.92633 WP_000168445.1.92649 WP_000168445.1.92676 WP_000168445.1.92705 WP_000168445.1.9271 WP_000168445.1.92734 WP_000168445.1.92810 WP_000168445.1.92823 WP_000168445.1.92987 WP_000168445.1.93007 WP_000168445.1.93022 WP_000168445.1.93105 WP_000168445.1.93111 WP_000168445.1.93121 WP_000168445.1.93168 WP_000168445.1.93221 WP_000168445.1.93223 WP_000168445.1.93239 WP_000168445.1.93302 WP_000168445.1.9336 WP_000168445.1.93387 WP_000168445.1.93469 WP_000168445.1.93511 WP_000168445.1.93512 WP_000168445.1.93635 WP_000168445.1.93657 WP_000168445.1.9374 WP_000168445.1.9375 WP_000168445.1.93754 WP_000168445.1.93780 WP_000168445.1.93828 WP_000168445.1.93842 WP_000168445.1.93843 WP_000168445.1.93875 WP_000168445.1.93909 WP_000168445.1.93919 WP_000168445.1.93938 WP_000168445.1.93984 WP_000168445.1.9399 WP_000168445.1.94017 WP_000168445.1.94079 WP_000168445.1.94107 WP_000168445.1.94142 WP_000168445.1.94215 WP_000168445.1.94303 WP_000168445.1.94365 WP_000168445.1.94390 WP_000168445.1.94415 WP_000168445.1.94527 WP_000168445.1.94573 WP_000168445.1.94579 WP_000168445.1.94586 WP_000168445.1.94593 WP_000168445.1.94650 WP_000168445.1.94659 WP_000168445.1.94662 WP_000168445.1.94700 WP_000168445.1.94745 WP_000168445.1.94782 WP_000168445.1.94820 WP_000168445.1.94850 WP_000168445.1.94851 WP_000168445.1.94864 WP_000168445.1.94952 WP_000168445.1.95006 WP_000168445.1.95055 WP_000168445.1.95099 WP_000168445.1.95165 WP_000168445.1.95239 WP_000168445.1.95246 WP_000168445.1.9525 WP_000168445.1.95255 WP_000168445.1.95265 WP_000168445.1.95338 WP_000168445.1.95412 WP_000168445.1.95547 WP_000168445.1.95590 WP_000168445.1.95625 WP_000168445.1.95675 WP_000168445.1.95716 WP_000168445.1.95776 WP_000168445.1.95884 WP_000168445.1.95890 WP_000168445.1.95906 WP_000168445.1.96025 WP_000168445.1.96044 WP_000168445.1.96054 WP_000168445.1.96094 WP_000168445.1.96127 WP_000168445.1.96144 WP_000168445.1.96188 WP_000168445.1.96211 WP_000168445.1.96212 WP_000168445.1.96319 WP_000168445.1.9633 WP_000168445.1.96359 WP_000168445.1.96539 WP_000168445.1.96552 WP_000168445.1.96610 WP_000168445.1.96625 WP_000168445.1.9664 WP_000168445.1.96675 WP_000168445.1.9670 WP_000168445.1.96750 WP_000168445.1.96792 WP_000168445.1.96801 WP_000168445.1.96803 WP_000168445.1.96925 WP_000168445.1.96938 WP_000168445.1.96946 WP_000168445.1.96957 WP_000168445.1.96978 WP_000168445.1.97154 WP_000168445.1.97184 WP_000168445.1.97287 WP_000168445.1.97291 WP_000168445.1.97422 WP_000168445.1.97441 WP_000168445.1.97497 WP_000168445.1.97505 WP_000168445.1.97599 WP_000168445.1.97606 WP_000168445.1.97615 WP_000168445.1.97690 WP_000168445.1.97819 WP_000168445.1.97840 WP_000168445.1.97938 WP_000168445.1.97986 WP_000168445.1.98036 WP_000168445.1.98080 WP_000168445.1.98086 WP_000168445.1.98158 WP_000168445.1.98263 WP_000168445.1.98418 WP_000168445.1.98448 WP_000168445.1.98457 WP_000168445.1.9850 WP_000168445.1.98607 WP_000168445.1.98762 WP_000168445.1.9877 WP_000168445.1.98801 WP_000168445.1.98818 WP_000168445.1.99163 WP_000168445.1.99335 WP_000168445.1.99350 WP_000168445.1.99360 WP_000168445.1.99363 WP_000168445.1.99388 WP_000168445.1.99397 WP_000168445.1.99463 WP_000168445.1.99483 WP_000168445.1.99546 WP_000168445.1.99579 WP_000168445.1.99595 WP_000168445.1.99671 WP_000168445.1.99676 WP_000168445.1.99764 WP_000168445.1.99837 WP_000168445.1.99841 WP_000168445.1.99996 AE014613|CDS_3836613-3838301 AL513382|CDS_3851123-3852811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]