SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488653103|ref|YP_007924906.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty21a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488653103|ref|YP_007924906.1|
Domain Number 1 Region: 365-552
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.11e-32
Family Pyruvate oxidase and decarboxylase PP module 0.0047
Further Details:      
 
Domain Number 2 Region: 7-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.44e-31
Family Pyruvate oxidase and decarboxylase Pyr module 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|488653103|ref|YP_007924906.1|
Domain Number - Region: 219-336
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00419
Family Pyruvate oxidase and decarboxylase, middle domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488653103|ref|YP_007924906.1|
Sequence length 556
Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
Sequence
MSVSAFNRRWAAVILEALTRHGVRHVCIAPGSRSTPLTLAAAENPAFIHHTHFDERGLGH
LALGLAKVSQQPVAVIVTSGTAVANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAI
RQAGMFASHPSQTLSLPRPTQDIPARWLVSTIDNALAMLHAGALHINCPFAEPLYGDMND
TGLVWQQRLGDWWQDEKPWLREARRLASDKQRDWFFWRQKRGVVVAGRMSAEEGKKVAQW
AQTLGWPLIGDVLSQTGQPLPCADLWLGNAKAVTELQQAQIVVQLGSSLTGKRLLQWQAT
CVPEEYWVIDNIEGRLDPAHHRGRRLVAKIADWLELHPAEKRKPWCVEIPRLAELAWQRV
VAQRDTFGEAQLAHRIRDYLPEQGQLFVGNSLVVRLIDALSQLPAGYPVYSNRGASGIDG
LLFTAAGVQRASAKSTLAIVGDLSALYDLNALALLRQVSAPFVLIVVNNNGGQIFSLLPT
PQSKRERFYLMPQNVHFDHAAAMFNLRYHRPENWEELESALAGAWRTPATTVIELVVNDT
DGAQTLQQLLAQVSHL
Download sequence
Identical sequences WP_015606113.1.53154 gi|488653103|ref|YP_007924906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]