SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28210371|ref|NP_781315.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28210371|ref|NP_781315.1|
Domain Number 1 Region: 31-169
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.95e-26
Family N-acetyl transferase, NAT 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28210371|ref|NP_781315.1|
Sequence length 172
Comment acetyltransferase [Clostridium tetani E88]
Sequence
MPARQMDLLANTSENKFIKNYLKGGTNMEHTIKDFNKIKDIDLIMKIWLNSNLQAHDFIS
DRYWIENYDEVKKLLPQSHLRVYWKDEQPIGFIGIVDGYIAGIFVDSNYRCQGIGLALLE
DAKKQYNKLSLDVYEKNQGAFRFYKRNGFQKVSSKVDDINKEIEYHMIWKKK
Download sequence
Identical sequences Q897T4
212717.CTC00643 WP_011098918.1.12609 WP_011098918.1.27827 WP_011098918.1.49058 WP_011098918.1.52649 WP_011098918.1.71400 WP_011098918.1.81004 WP_011098918.1.83101 WP_011098918.1.84243 WP_011098918.1.96257 gi|28210371|ref|NP_781315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]