SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28210994|ref|NP_781938.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28210994|ref|NP_781938.1|
Domain Number 1 Region: 125-306
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.1e-21
Family N-acetyl transferase, NAT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28210994|ref|NP_781938.1|
Sequence length 314
Comment acetyltransferase [Clostridium tetani E88]
Sequence
MLTAFIKRLILRMDLITIKRNAMLNITNLNKNNLFHFKILNNTRLSFNSLNVDFLLSYEN
SGFFDKMLLRKEVFLLKDLKEYYGYLWCTKKTSYYLINSLNLKRKFMKPKYMSILLGYLR
KNSIFKYMCEDNGFNISLLKESGFYVSKCTIEMDLNLEHVVPLNNQELVKSKGIYFKTLK
PNKEESIRCHIQNEVFKTDTREPLTVDDIISDENQSYYLPEGAIFVMENNEYIGYGQIIL
ISDIPIIVNVGILKEYRGRGIGRALVYHLLDIIKELNYEEAFITVDSINKVALNLYKDCG
FKFNRKIYTMELKT
Download sequence
Identical sequences Q895G5
gi|28210994|ref|NP_781938.1| WP_011099537.1.12609 WP_011099537.1.27827 WP_011099537.1.49058 WP_011099537.1.52649 WP_011099537.1.71400 WP_011099537.1.81004 WP_011099537.1.83101 WP_011099537.1.84243 WP_011099537.1.96257 212717.CTC01310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]