SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28212164|ref|NP_783108.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28212164|ref|NP_783108.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 5.76e-36
Family Ribosomal protein L6 0.0000337
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.03e-26
Family Ribosomal protein L6 0.0000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28212164|ref|NP_783108.1|
Sequence length 180
Comment 50S ribosomal protein L6 [Clostridium tetani E88]
Sequence
MSRIGRLPIAIPNGVTVTVSPENVVTVKGPKGELTKTMHPNIDIAIEENSVIVTRKNDEK
QNRSLHGLTRSLVNNMVVGVTEGYEKKLELVGVGYRAQLQGKKLVLNLGFSHPVEIEAKE
GVEFQLDGTNKITVKGIDKELVGAVASDIRSWRKPEPYKGKGIKYENEAIRRKEGKTGKK
Download sequence
Identical sequences A0A1T4MQ12 Q890Q0
WP_011100706.1.12609 WP_011100706.1.27827 WP_011100706.1.49058 WP_011100706.1.52649 WP_011100706.1.71400 WP_011100706.1.81004 WP_011100706.1.83101 WP_011100706.1.84243 WP_011100706.1.96257 212717.CTC02588 gi|28212164|ref|NP_783108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]