SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28209915|ref|NP_780859.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28209915|ref|NP_780859.1|
Domain Number 1 Region: 20-128
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.33e-22
Family N-acetyl transferase, NAT 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28209915|ref|NP_780859.1|
Sequence length 155
Comment acetyltransferase [Clostridium tetani E88]
Sequence
MYQVYISEDFIVTTDPKKIDVNAVCELLSRSYWSEKRNREIVEKFIENSLCFSLYHKDRQ
IGFARVVTDYITFGYVRDVFIHEDYRGKGLGKWLINCVITHPDMINIERLMLATKDAQTF
YQYHGFGQLQKPEAFMERLGTINKATIGELNIATS
Download sequence
Identical sequences A0A1T4RKB5 Q899M8
212717.CTC00144 WP_011098468.1.12609 WP_011098468.1.27827 WP_011098468.1.49058 WP_011098468.1.52649 WP_011098468.1.71400 WP_011098468.1.81004 WP_011098468.1.83101 WP_011098468.1.84243 WP_011098468.1.96257 gi|28209915|ref|NP_780859.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]