SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28210404|ref|NP_781348.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28210404|ref|NP_781348.1|
Domain Number 1 Region: 89-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000418
Family NfeD domain-like 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|28210404|ref|NP_781348.1|
Domain Number - Region: 10-72
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00209
Family Glycerol-3-phosphate transporter 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28210404|ref|NP_781348.1|
Sequence length 146
Comment hypothetical protein CTC00680 [Clostridium tetani E88]
Sequence
MYSQILLWIVIGATAITVDIFTSSFLFVWFTIGSIVALIISSLGYSFSVQFIAFIFTSVV
LLAVGYPIVRKTIKKSVPKTLPMGQNYINRIITVEKDIKEEELIKIDGIYWTVLNEGKLI
KKGEKAKIIALNGNKFILKKYEEDAK
Download sequence
Identical sequences A0A1T4QQ28 Q897Q1
212717.CTC00680 gi|28210404|ref|NP_781348.1| WP_011098951.1.12609 WP_011098951.1.27827 WP_011098951.1.49058 WP_011098951.1.52649 WP_011098951.1.71400 WP_011098951.1.81004 WP_011098951.1.83101 WP_011098951.1.84243 WP_011098951.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]