SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28210585|ref|NP_781529.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28210585|ref|NP_781529.1|
Domain Number 1 Region: 6-175
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.55e-41
Family N-acetyl transferase, NAT 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28210585|ref|NP_781529.1|
Sequence length 186
Comment acetyltransferase [Clostridium tetani E88]
Sequence
MFSEDLLKSDRIKITALREEDIETITKWYEDTNFLRVFDFNPSAPKTSWKIREWLMEEVS
SSNNYFFAIRKKDANKILGYVEIEKINWNNGVGGIAIGIGDSSEWGKGYGSEALSLAMDF
AFRELNLHRLQLITISYNERAIKSYEKLGFKKEGIYREAVNRDGKRYDIYLYGVLKREWK
ELKKIG
Download sequence
Identical sequences A0A1T4LH44 Q896X4
gi|28210585|ref|NP_781529.1| WP_011099128.1.12609 WP_011099128.1.27827 WP_011099128.1.49058 WP_011099128.1.81004 WP_011099128.1.83101 WP_011099128.1.96257 212717.CTC00869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]