SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28211154|ref|NP_782098.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28211154|ref|NP_782098.1|
Domain Number 1 Region: 18-155,190-225,257-539
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.12e-66
Family Pyridoxal-dependent decarboxylase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28211154|ref|NP_782098.1|
Sequence length 575
Comment histidine decarboxylase [Clostridium tetani E88]
Sequence
MKNPMTQPTKDPNTVYPKVPGIDYDKFKLSEDKMTSKQINDALEELHNYISNQQINFLGY
QINQSFNYMKDLKEYLNVHMNNIGDPFVSGNFTVNTKFLERAVLDYFASLWNAQWPHESK
GDSNTNDWKNSYWGYVVSMGSTEANFFGIWNARDYLSGKALLLDTSTHKRAKSASINGNP
QSVEPRVLNYQAKSLEDNPNMYTPIAFYSQDTHYSIIKGMRILNFTTFNEAGSGKFECPL
KYPEDYPKGFSINYLDENGWPFEVPSNNDGSVFIPALKKLVEAFASKGYPIFVNFNYGTT
FKGSYDNVEKAIDELVPILKKYNLYEREIIFDKNNKNSDTRTGFWFHVDGALGAAYMPFL
EMTTDNEDFPVFDFRLKDVHSISMSGHKWIGVPWPCGIYMSKIKYQLLPPDNPNYIGSPD
STFAGSRNAFSSLILWYYIATHSYEDCKNMILDCQDTAKYTVEKLNELSKKLGIDLWVEY
SSKSLTIRFKEANPDIVFKYSLSGEILYVNGEKRAYSHIYIMPHVTKDLIDKFIKDLSKP
GAFPEQVSHLEKDGVNFNSNSHKGIYVPQIGRGFK
Download sequence
Identical sequences A0A1T4NUJ4 Q894Q7
gi|28211154|ref|NP_782098.1| 212717.CTC01478 WP_011099695.1.12609 WP_011099695.1.27827 WP_011099695.1.49058 WP_011099695.1.81004 WP_011099695.1.83101 WP_011099695.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]