SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28211466|ref|NP_782410.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28211466|ref|NP_782410.1|
Domain Number 1 Region: 9-199
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.05e-28
Family N-acetyl transferase, NAT 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28211466|ref|NP_782410.1|
Sequence length 203
Comment acetyltransferase [Clostridium tetani E88]
Sequence
MGGLIYLVIRGAKPEDAEKAAELISMAWDELACIFAGSKDKKEVNKVISTFCKEKNNRFS
YEYIDVVESEGSIAGLVLAFPAEKEMKLNVPIMKKLPSLYKRKISTYKEEVIPMLNSEEA
KPGEYYIDSIAVHPDYRKKGLGKKLLMTARKRALKRGFKKVSLIVKPKNKGAIKLYKSSG
YNMAGTVDMPGTDYYRMVKKYTV
Download sequence
Identical sequences Q893J5
gi|28211466|ref|NP_782410.1| 212717.CTC01823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]