SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28211698|ref|NP_782642.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28211698|ref|NP_782642.1|
Domain Number 1 Region: 21-153
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000846
Family N-acetyl transferase, NAT 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28211698|ref|NP_782642.1|
Sequence length 165
Comment hypothetical protein CTC02080 [Clostridium tetani E88]
Sequence
MVDIFIKYHDIELSTVTKNCVEDIYQSLSLDKECINKNICFDYIYERFLEYYISENEFFL
KIKNKDNSIGIIKGRMEFTNTVEIWLNCFYIYEIYRNKGQGAKVLDIFTKEIKKEFLVQD
IYSVLSNDKLKYLGFWYKNGYSVIKNIKKDYGYKYNNFIILKKER
Download sequence
Identical sequences A0A1T4ND16 Q892L6
212717.CTC02080 gi|28211698|ref|NP_782642.1| WP_011100237.1.12609 WP_011100237.1.27827 WP_011100237.1.49058 WP_011100237.1.52649 WP_011100237.1.71400 WP_011100237.1.81004 WP_011100237.1.83101 WP_011100237.1.84243 WP_011100237.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]