SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161723105|ref|YP_290238.2| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161723105|ref|YP_290238.2|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily L21p-like 2.88e-29
Family Ribosomal protein L21p 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161723105|ref|YP_290238.2|
Sequence length 103
Comment 50S ribosomal protein L21 [Thermobifida fusca YX]
Sequence
MYAIVRAGGRQEKVSVDDVVTIDRVAKEAGDTLNLEPLLVVDNGKVVSDAAELNKYQVTA
EVLGEVTGPKIKILKYKSKTGYKRRLGHRQKYTQIRVTGIAAK
Download sequence
Identical sequences Q47MV4
WP_011292605.1.46431 WP_011292605.1.72373 WP_011292605.1.82272 gi|161723105|ref|YP_290238.2| 269800.Tfu_2182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]