SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161723109|ref|YP_288911.2| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161723109|ref|YP_288911.2|
Domain Number 1 Region: 17-327
Classification Level Classification E-value
Superfamily Aldolase 1.59e-96
Family HMGL-like 0.00000000217
Further Details:      
 
Domain Number 2 Region: 455-556
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 3.27e-37
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.0000773
Further Details:      
 
Domain Number 3 Region: 395-444
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.00000000000000149
Family DmpG/LeuA communication domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161723109|ref|YP_288911.2|
Sequence length 559
Comment 2-isopropylmalate synthase [Thermobifida fusca YX]
Sequence
MPFHRYQPFKPVDLPDRTWPSKTITKAPRWLSTDLRDGNQALIEPMDTERKREIFDLLVR
MGYKEIEVGFPAASQTDYDFVRYLIEEDRIPDDVQISVLTQAREELIERTVQSLVGAKRA
TVHLYNATSPEFRRIVFGVNREECKGIAVEGTRTVLKFAEQYLKDTEYFGYEYSPEIFID
TELEFALEVCEAVMDVYQPGPDREIILNLPATVERATPNVYADQIEWMSRNLSRREYVCL
SVHPHNDRGTAVAAAELAVMAGADRVEGCLFGHGERTGNVCLVTLGLNLFSQGIDPMIDF
SNIDEIRRTVEHCTQLPVNPRHPYGGDLVYTAFSGSHQDAIKKGFHALEADAAAAGVPVD
EYRWNMPYLPIDPKDVGRTYEAVIRVNSQSGKGGVSYVLQRDYSIDLPRRLQIEFSRVVQ
QFADAEGGEFSGERIWEIFTDTYLSEGVVGVMAYRSETSEDGEYCISADVRLRGEIREIT
GTGNGPISAFVDALAGVGFKLRVLDYSEHALSEGGDARAAAYVEAEVDGNVLWGVGISSN
ITTASLKAVCSAVNRAQQS
Download sequence
Identical sequences gi|161723109|ref|YP_288911.2| 269800.Tfu_0850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]