SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|72161445|ref|YP_289102.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72161445|ref|YP_289102.1|
Domain Number 1 Region: 44-335
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-77
Family Protein kinases, catalytic subunit 0.00000215
Further Details:      
 
Domain Number 2 Region: 531-591
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|72161445|ref|YP_289102.1|
Domain Number - Region: 465-527
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 
Domain Number - Region: 397-459
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 597-638
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|72161445|ref|YP_289102.1|
Sequence length 672
Comment tyrosine protein kinase:Serine/threonine protein kinase:PASTA [Thermobifida fusca YX]
Sequence
MVPPRVSLLLRAETVVRPSVSAFPRKLPLVDMTAADALVGTTLAHRYRVESKIANGGMAT
VFLAHDLRLDRRVALKVMHANLARDPQFVQRFINEALAVAKLSHPNVVQVYDQGSDQGHV
YLAMEYVAGQTLRAALKARTRFSPAEALRIMVPILAGLGAAHQAGMVHRDMKPENVLITH
DGQIKVADFGLARAAEASQQGLTKTGTLMGTAAYLSPEQITHSTADARSDVYACGIMLYE
LLTGRQPHTGDSPIAVAYQHVNEDVPRPSRVVPGIPPEVDSLVVRATERDPAYRLANAGQ
FLAAVFAAQKALDEQPSAAVTSVMEMAPAPAGDTAEDSDNATRTLQGVELPPVEYDDYED
DRPPRPSLRTPLLVATVLLLVVAVGFGWWMVDGRYETVPDLVGVESDEARRDLRMLGFRV
QTAEEPAYSDEAPPGTVAATDPEAGSRLLPDTLVTLILSAGPQYVEMPDVEGASVAEARD
ALKEVGLTDIVEDEITSFDNPPGTVITTKPAPGEKANREESVTLTISAGFPMPNVVGQKV
DDARRLLESSDLEVTVVEEHHDEVPEGHVISQEPEAETTVGAGQSVTLTVSSGPELVEVP
DIRGWKVDKARKELEERGFEVTVHQVIGNRVGDYNPKGEAPKGSTIEIWTSPFGRERDRD
RGREDRLWIGLD
Download sequence
Identical sequences Q47R38
269800.Tfu_1041 TfR72 gi|72161445|ref|YP_289102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]