SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|72161983|ref|YP_289640.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72161983|ref|YP_289640.1|
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily AF1862-like 0.000000000000122
Family Cas Cmr5-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72161983|ref|YP_289640.1|
Sequence length 159
Comment hypothetical protein Tfu_1581 [Thermobifida fusca YX]
Sequence
MAERVDQQMAAQAEKVIGPLVTDPQLAQRIRTRMRQFPMRLRSSGLVAAFAFAESKSGSA
DPLEQAYSRLCKAIIEHAAKRKLLPGLTPQSTPREFLDVLTKADLPTHSRLSAEIDLLAG
WLSRIAEARYGKLAAAATEHANQENPGESADSDTGEERE
Download sequence
Identical sequences Q47PK2
WP_011292012.1.46431 WP_011292012.1.72373 WP_011292012.1.82272 gi|72161983|ref|YP_289640.1| 269800.Tfu_1581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]