SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|72162714|ref|YP_290371.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72162714|ref|YP_290371.1|
Domain Number 1 Region: 3-308
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.05e-40
Family Nitrous oxide reductase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|72162714|ref|YP_290371.1|
Sequence length 353
Comment hypothetical protein Tfu_2315 [Thermobifida fusca YX]
Sequence
MTRRRLLWIGSYTPDSGIAGHAAGVQRVWFDTDTAALSKAELAAPASGPSFVVPATDQTM
VYAVNELAAGRVTAFAVHDTQQLTEAGSAITGGSYPCHLLYHPAGRHLIVANYGDGSVSV
HALDPAGVPTAPVQRLTHTGAGPRTDRQEGPHAHSVYVAPGGTHLLVVDLGTDELRCFPF
APEADQPAGPQHIAARLEPGSGPRHLAIHSSGHLYVAGELDSRVYVLRFDPATAQAEILD
AVPATGAADDNYPAEIALSADERRLYVANRGADTIATFEVSADGTRIRRLADTPTGGAWP
RHFALVDGYLVVANQNSETLTVLPIDAESGIPGPACSTLDLPTPVCVLPAAVE
Download sequence
Identical sequences Q47MH2
269800.Tfu_2315 WP_011292738.1.46431 WP_011292738.1.72373 WP_011292738.1.82272 gi|72162714|ref|YP_290371.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]