SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|72163465|ref|YP_291122.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72163465|ref|YP_291122.1|
Domain Number 1 Region: 8-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-76
Family Protein kinases, catalytic subunit 0.0000000781
Further Details:      
 
Domain Number 2 Region: 493-554
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000314
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|72163465|ref|YP_291122.1|
Domain Number - Region: 427-486
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000275
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 357-421
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000602
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|72163465|ref|YP_291122.1|
Sequence length 598
Comment serine/threonine protein kinase [Thermobifida fusca YX]
Sequence
MSQPRLLGGRYQLEAPVGRGGMAEVFRARDLRLDRLVAVKTLRSDLARDPTFQARFRREA
QSAASLNHPSIIAVYDTGEDVIDGVPIPYIVMEYVDGRTLKELLEDNRRLLPERTLEITD
GILRALAAAHARGIVHRDIKPANVMLTRQAEVKVMDFGIARAMNDAQATMTQTSQVIGTA
QYLSPEQARGERVDVRSDIYSTGCVLYELLTGRPPFVGDSPVSIAYQHVREEPIPPTELD
PEIPEWIEAIVLRAMAKDREQRYQTAEEMRADIQRGLQGMPTAASTMALSAANDGATTAL
PPTRDDGYDDYDDYPYDDEDRRRGSGNKVLWVLLGTAVLAAAAFLGWLLFNPGTDNITIP
NVAGMSVEEATETLQEKGFENIEVADEPTPSNEIEEGKVVGTDPEIGETVPPDTEITILI
SGGPEMIEMPDLVGMSQADALGEINRAGLARGEITHQESDEPQGTVLSTDPKAGTEVEPG
TKVNLVVAKASTKVEVPSLAGMNEDQARERLAELGLTLEAQTQETSDATPGTAIAQSPQA
GTKVERGTTVTVTFAKEPQRPEPPTPPDPGSPGDETPFPPFPPDMEEWNPFSRRGEGD
Download sequence
Identical sequences Q47KC3
gi|72163465|ref|YP_291122.1| 269800.Tfu_3066 TfR68 WP_011293483.1.46431 WP_011293483.1.72373 WP_011293483.1.82272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]