SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|72162358|ref|YP_290015.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72162358|ref|YP_290015.1|
Domain Number 1 Region: 341-981
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.79e-289
Family Cellulases catalytic domain 0.0000000000021
Further Details:      
 
Domain Number 2 Region: 37-139
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.88e-33
Family Cellulose-binding domain family II 0.00014
Further Details:      
 
Domain Number 3 Region: 157-237
Classification Level Classification E-value
Superfamily PKD domain 0.0000157
Family PKD domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|72162358|ref|YP_290015.1|
Domain Number - Region: 243-306
Classification Level Classification E-value
Superfamily CalX-like 0.0222
Family CalX-beta domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|72162358|ref|YP_290015.1|
Sequence length 984
Comment cellulose 1,4-beta-cellobiosidase [Thermobifida fusca YX]
Sequence
MRSLLSPRRWRTLASGALAAALAAAVLSPGVAHAAVACSVDYDDSNDWGSGFVAEVKVTN
EGSDPIQNWQVGWTFPGNQQITNGWNGVFSQSGANVTVRYPDWNPNIAPGATISFGFQGT
YSGSNDAPTSFTVNGVTCSGSQPANLPPDVTLTSPANNSTFLVNDPIELTAVASDPDGSI
DRVEFAADNTVIGIDTTSPYSFTWTDAAAGSYSVTAIAYDDQGARTVSAPIAIRVLDRAA
VIASPPTVRVPQGGTADFEVRLSNQPSGNVTVTVARTSGSSDLTVSSGSQLQFTSSNWNQ
PQKVTIASADNGGNLAEAVFTVSAPGHDSAEVTVREIDPNTSSYDQAFLEQYEKIKDPAS
GYFREFNGLLVPYHSVETMIVEAPDHGHQTTSEAFSYYLWLEAYYGRVTGDWKPLHDAWE
SMETFIIPGTKDQPTNSAYNPNSPATYIPEQPNADGYPSPLMNNVPVGQDPLAQELSSTY
GTNEIYGMHWLLDVDNVYGFGFCGDGTDDAPAYINTYQRGARESVWETIPHPSCDDFTHG
GPNGYLDLFTDDQNYAKQWRYTNAPDADARAVQVMFWAHEWAKEQGKENEIAGLMDKASK
MGDYLRYAMFDKYFKKIGNCVGATSCPGGQGKDSAHYLLSWYYSWGGSLDTSSAWAWRIG
SSSSHQGYQNVLAAYALSQVPELQPDSPTGVQDWATSFDRQLEFLQWLQSAEGGIAGGAT
NSWKGSYDTPPTGLSQFYGMYYDWQPVWNDPPSNNWFGFQVWNMERVAQLYYVTGDARAE
AILDKWVPWAIQHTDVDADNGGQNFQVPSDLEWSGQPDTWTGTYTGNPNLHVQVVSYSQD
VGVTAALAKTLMYYAKRSGDTTALATAEGLLDALLAHRDSIGIATPEQPSWDRLDDPWDG
SEGLYVPPGWSGTMPNGDRIEPGATFLSIRSFYKNDPLWPQVEAHLNDPQNVPAPIVERH
RFWAQVEIATAFAAHDELFGAGAP
Download sequence
Identical sequences Q47NH7 Q9XCD4
269800.Tfu_1959 gi|72162358|ref|YP_290015.1| WP_011292383.1.82272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]