SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000440 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000440
Domain Number 1 Region: 482-592,705-855
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.18e-54
Family Phosphate binding protein-like 0.00000998
Further Details:      
 
Domain Number 2 Region: 84-468
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.85e-33
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000440   Gene: ENSOARG00000000438   Transcript: ENSOART00000000468
Sequence length 1053
Comment pep:known_by_projection chromosome:Oar_v3.1:25:40007188:40681957:-1 gene:ENSOARG00000000438 transcript:ENSOART00000000468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHVHMCLLWTMLAYLGWCIFPTSKLSYQAETPAQNSHHPAARSPASAVIGGGGKGEPIS
RPGVDPSSPPGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAV
QEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDG
EAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQK
VDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWV
FVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQEGYLQML
QISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITG
LTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQG
LTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQL
HNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYLDYSVGILIKKPEEKISIFS
LFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVYGAF
VQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVE
MSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGIRKAKKGN
YAFLWDVAVVEYAALTDDDCSVTVIANSVSSKGYGIALQHGSPYRDLFSQRILELQDTGD
LDVLKQKWWPHTGRCDLTSHTSAQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWN
SNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPSQALEP
TREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLF
RQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences W5NQK0
ENSOARP00000000440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]