SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000681 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000681
Domain Number 1 Region: 216-322
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-18
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 86-131
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000701
Family Kringle modules 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000681   Gene: ENSOARG00000000662   Transcript: ENSOART00000000713
Sequence length 460
Comment pep:known_by_projection chromosome:Oar_v3.1:24:2354639:2358305:1 gene:ENSOARG00000000662 transcript:ENSOART00000000713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRAPKALLLLLLLRLLPPRGASAGSLQSPGLSRGVGGAEVSAGRAQKPPGKPGFALTH
TEAILQISCGSGPGIHGSWDNSIPTACSNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMP
GYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLAR
GRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPD
RNCSWVLAPPGAALELAFRLFELADPRDRLARRDATSGSLLRAFDGARPPPPGPLRLRAA
ALRLTFRSDARGHAQGFALTFQGLQDADADPAPLEGSTQTPAAPLDGANVSCSPGPGAPE
ASMGAQVFSTVTAVSVLLLLVLSLLLLLLGRGCLLAPGKGSPTLGPSRDPTRSWAVWYRR
PRGVALPCPPGDPQVEGLTASYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences W5NR91
ENSOARP00000000681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]