SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000922 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000922
Domain Number 1 Region: 215-711
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 4.19e-171
Family Aconitase iron-sulfur domain 0.00000000000713
Further Details:      
 
Domain Number 2 Region: 715-968
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 3.73e-72
Family LeuD-like 0.0000000154
Further Details:      
 
Domain Number 3 Region: 19-145
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 3.73e-25
Family Aconitase iron-sulfur domain 0.00000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000922   Gene: ENSOARG00000000881   Transcript: ENSOART00000000955
Sequence length 970
Comment pep:known_by_projection chromosome:Oar_v3.1:18:29884577:29931296:1 gene:ENSOARG00000000881 transcript:ENSOART00000000955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPSAGYAFEYLIETLNDSSHKKFFNVPRLGGTKYESDVLPYSIRVLLEAAVRNCDGFL
MKKEDVMNILDWKTKQSNVEVPFFPARVLLQDFTGIPAMVDFAAMREAVKTLGGDPKKVH
PACPTDLTVDHSLQIDFNKWNDSAIQNAPNPGGGDLQKAGKLSPLRVQPKKLPCRGQTTC
RGSCDSGELGRNSGKFSSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKW
SSRVFKNVAVIPPGTGMAHQVNLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGILGW
VGVGGIETEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAGKFV
EFFGSGVSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEHTGFDKAKLESMEAYLK
AVKLFRNEQDNSGEPEYSQVIQINLNSIVPSVSGPKRPQDRVALTDMKSDFQACLNEKVG
FKGFQIAAEKQNDIVSIHYEGSEYKLAHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVE
AGLQVKPYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIIGYGCSTCVGNTAPLSEAVL
NAVKQGDLVTCGVLSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTD
PTGKNIYLHDIWPSREEVHQIEEEHVVLSMFKALKEKIEMGNKRWNSLEAPDSVLFPWDL
KSTYIRCPSFFDKLTKEPVALQPIENAHVLLYLGDSVTTDHISPAGSIARSSAAAKYLTN
RGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAEL
YQKEGIPLIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQF
LPGESADSLGLSGRETFSLTFPEELSPGVTLNIKTSTGKVFSVIASFENDVEITLYKHGG
LLNFVARKFS
Download sequence
Identical sequences W5NRY2
ENSOARP00000000922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]