SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001034 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001034
Domain Number 1 Region: 74-154
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.25e-28
Family UDP-glucose pyrophosphorylase 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001034   Gene: ENSOARG00000001000   Transcript: ENSOART00000001068
Sequence length 154
Comment pep:known_by_projection scaffold:Oar_v3.1:JH922612.1:21:799:-1 gene:ENSOARG00000001000 transcript:ENSOART00000001068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERYGTRCTVPWCARLHSLGPRVIPPTPTCVAPALLRTRTRTPAQPQTEPSPHPEGGLPVP
SARGTRPFARLAQPCLPCRYIMTSEFTLGPTAKFFKEHDFFHLDPNNVIMFEQRMLPAVS
FDGRAILERKDKVAMAPDGNGGLYSALEDHQILE
Download sequence
Identical sequences W5NS94
ENSOARP00000001034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]