SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001718 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001718
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.14e-45
Family Hedgehog (development protein), N-terminal signaling domain 0.00000973
Further Details:      
 
Domain Number 2 Region: 104-250
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 7.85e-37
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001718   Gene: ENSOARG00000001635   Transcript: ENSOART00000001761
Sequence length 301
Comment pep:novel scaffold:Oar_v3.1:JH923726.1:21:1865:1 gene:ENSOARG00000001635 transcript:ENSOART00000001761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFIPRQRCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRD
RNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGGCFPGNATVRLRSGERKG
LRELHRGDWVLAADAAGRVVPTPVLLFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFA
ARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLL
VNDVLASCYAVLESHQWAHRAFAPLRLLHALGALLPGGAVQPTGMHWYSRFLYRLAEELL
D
Download sequence
Identical sequences W5NU74
ENSOARP00000001718 ENSOARP00000001737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]