SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001734 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001734
Domain Number 1 Region: 342-519,554-720
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.89e-78
Family YicI catalytic domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 1215-1408,1458-1619
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.08e-74
Family YicI catalytic domain-like 0.00035
Further Details:      
 
Domain Number 3 Region: 98-341
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.79e-50
Family YicI N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 4 Region: 965-1212
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.42e-47
Family YicI N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 5 Region: 1622-1702
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000115
Family Putative glucosidase YicI, domain 3 0.021
Further Details:      
 
Domain Number 6 Region: 723-803
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000201
Family Putative glucosidase YicI, domain 3 0.023
Further Details:      
 
Domain Number 7 Region: 937-989
Classification Level Classification E-value
Superfamily Trefoil 0.0000000439
Family Trefoil 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001734   Gene: ENSOARG00000001636   Transcript: ENSOART00000001777
Sequence length 1842
Comment pep:known_by_projection chromosome:Oar_v3.1:1:220311409:220425966:1 gene:ENSOARG00000001636 transcript:ENSOART00000001777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKKFSGLEITLIVLFAIVTIIAIALVVVLATKTPAVEGVRSYIFPIHISPSSFFTSKT
QFVKISDSTGGTCPSVLNDPINQRINCIPERSPTQTLCAARGCCWRPWNDSVIPWCFFVN
NHGYNAEKVTSTNAGLEAKLKRKASPTLFGNDINSVLLTTQNQTRNRVRFKITDPNNRRY
EVPHQFVKEFSGTAASDPLYNLEVIHDPFSIKISRKSNNKILFDTSIGPLVYSDQYLQIS
ARLPNEYIYGLGEHIHKRFRHDLYWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGK
SFGVFLMNSNAMEIFIQPTPIVTYRVIGGILDFYIFLGDTPEQVVQQYQELIGRPAMPAY
WNLGFQLSRWNYKTLDVVKAVVKRNREAGIPFDTQITDIDYMEDKKIFTYDQVAFNGLPE
FVQDLHAHGQKYVIILDPAVSIDKRVNGTAYESYDRGTAQKVWVNESDGTTAIIGEVWPG
LTVYPDFTNPSCIEWWANECYLFHQQVNYDGLWIDMNEVSSFVQGSKKGCSANNLNYPPF
TPDILDKLMYSKTICMDAMQYWGKQYDVHSLYGYSMSIATEKAIEKVLPNKRSFILTRST
FAGSGSHSAHWLGDNTASWEQMEWSITGMLEFGLFGIPLVGADICGFVAETTEELCRRWM
QLGAFYPYARNHNADGYEHQDPAHFGQDSLLVKSSKHYLNIRYALLPFLYTLFYKAHMFG
ETVARPFLHEFYEDTNSWIEDTQFLWGPSLLITPVLKQGAETVSAYIPDATWYDFETGVK
RPWRKQRVDMQLPGDKIGLHLRGGYIIPFQEPAVTTTASRKNPLGLIVALNDNNTAKGDF
FWDDGETKDTIQKGNYILYTFSVSNNKLDIICMHSSYPEGTALAFETVKVLGLIDTVTEV
SVIEDNQPLRAHYNFSYDASNQILLIYNLTFNLGGNFTVQWDQTFLEVEKFTCYPDSDTA
TKERCEERGCLWQTAQLGSKAPECYFPKEDNSYLVHSTQYSSVGITADLQLNTANPRIKL
PSDSISSLRVEVKYHKDDMLQFKIYDAQNKRYEVPVPLNIPTTPTSTYETRLYDVEIKEN
PFGIQIRRRSTRRVIWDSRLPGFAFNNQFIQISTRLPSEYVYGFGEMEHTTFRRDLNWHT
WGMFTRDQPPGYKLNSYGFHPYYMALEDENNAHGVLLLNSNAMDVTFQPMPALTYRMIGG
ILDFYMFLGPSPEVVTKQYHEVIGQPVMPPYWALGFQLCRYGYRNTSQVEEVYNDMVAAR
IPYDVQYTDIDYMERQLDFTIDDEFRDLPQFVDKIRSEGMRYIIILDPAISGNETKPYPA
FERGQEKDVFVKWPNTNDICWAKVWPDLPNVTIDESLTEEEAVNASRAHAAFPDFFRNST
AEWWAREIIDFYNNQMKFDGLWIDMNEPSSFVNGTTTNQCRNTELNNNTFFPERFSPELT
KRTDGLHFRTMCMETEQILSDGSSVLHYDVHNLYGWSQLKPTYDALQKATGKRGIIISRS
TYPSAGRWSGHWFGDNYATWDNLEKSIIGMMEFSLFGMSYTGADICGFFNNSEYQLCARW
MQLGAFYPYARNHNSAFTRRQDPASWNKTFSTMSRDILNIRYTLLPYFYTQMHEIHAHGG
TVIRPLLHEFLNEKPTWDIFKQFLWGPAFMVTPVLEPYVDTVEGYVPNARWFDYHTGKDI
GVRETFHTFAAPLYEINLHVRGGYILPCQEPANNTFYSRQNYMKLIVAADDDQMAQGSLF
WDDGETIDTYERDLYSLVQFNLNKTILTSTILKNGYINRSEMRLGYIHIWGKEKMHVSEV
TLTHNGNKESVNFTEDQNLEILDIDLTGNNVTLDEPIEVNWS
Download sequence
Identical sequences W5NU90
ENSOARP00000001734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]