SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001791 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001791
Domain Number 1 Region: 20-145
Classification Level Classification E-value
Superfamily dUTPase-like 2.22e-28
Family dUTPase-like 0.0007
Further Details:      
 
Domain Number 2 Region: 147-271
Classification Level Classification E-value
Superfamily Acid proteases 2.18e-26
Family Retroviral protease (retropepsin) 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001791   Gene: ENSOARG00000001706   Transcript: ENSOART00000001834
Sequence length 288
Comment pep:novel chromosome:Oar_v3.1:15:131913:133079:-1 gene:ENSOARG00000001706 transcript:ENSOART00000001834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YNWGNNTEPIHTLRPIAELIRVTPGSAGLDLSSTTSTVLTPDSPTIKIPTGVKGPLLTGL
VGIIFGRSSLAMQGFTIISGVIDSDYTGEIQIMISPPTKTIQIHQGQRIALLLPYHTAIG
HTATQSERQEKGFGSSDMDSWITEIIQKHPMKTILVSGKSIVGLLDTEADVFCISGKDWP
RSWPTHTTENELVGLGRAPTVVKNWQFEDTCGTFQPYVVPSPPFTLWGRDVLSQMGVLLF
SPNEKVTSQMLQMGYDLSKGLGKQQTGVIEPICPTPCKKKSGNLGSPP
Download sequence
Identical sequences W5NUE7
ENSOARP00000001791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]