SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001852 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001852
Domain Number 1 Region: 72-161
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000143
Family Retroviral protease (retropepsin) 0.0022
Further Details:      
 
Domain Number 2 Region: 13-59
Classification Level Classification E-value
Superfamily dUTPase-like 0.00000017
Family dUTPase-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001852   Gene: ENSOARG00000001764   Transcript: ENSOART00000001899
Sequence length 161
Comment pep:novel chromosome:Oar_v3.1:1:221774181:221774733:1 gene:ENSOARG00000001764 transcript:ENSOART00000001899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGPLHSQNFDFSLGRSSLTSKGITVNPGIIGSDYKGKIQIMMSSQIQNKIAHLLLLPYTA
INFSHDIQTKRIKPNINIKINDKRFSGLFDIGSDITMISKHSWPLQKTSYQIIGVSQAKI
REIYQNIQIYSYEGPEVQPATLQPYIIDAPFNLMRRDLLMQ
Download sequence
Identical sequences W5NUK8
ENSOARP00000001852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]