SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001863 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001863
Domain Number 1 Region: 960-1099
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.8e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000178
Further Details:      
 
Domain Number 2 Region: 181-275
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000278
Family Calponin-homology domain, CH-domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001863   Gene: ENSOARG00000001771   Transcript: ENSOART00000001910
Sequence length 1105
Comment pep:known_by_projection chromosome:Oar_v3.1:5:14128089:14137026:1 gene:ENSOARG00000001771 transcript:ENSOART00000001910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEHVPSELWEPFYTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLEAPPNPSALLALL
ARRGTVPALPERPVQEADLRHQPILMGAHLAVIDALMVAFAFEWTKTLPGPLALASLEHK
LLFWVDTTIRRLQEKTEQEAAQRASPAAPADGVAPAQPSIRYRKDRAVARRAPCFPTVTS
LQDLASGAALAATIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLS
LEDLLYVPPPLKVNLMVLLAELFMCFEVLKPDFVQVKDLPDGHAASPQATEASTPQNNSG
SRHSMAHPHPRVPSDPRMTTHHPSPGSLKSSPSMSHMEALGKAWNRQLRPPSRPLSQAVS
FSTPFGLDSDVDVVMGDPVLLRSVSSDSLGPQRPVPARTPAQPPPETGDLPTIEEALQII
HSAEPRLLGPADGSFYLHSPEGSSKLPLASPYPPEGTSKPLPEGPTKVPAYLPHPEGPSK
PAPCPAGEVSKPPALPEGSPKVATSSPAASNSEVKMTSFAERKKQLVKAEVEAGSPVATP
GAPEALSSEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKNAFLQVQPREAGGEAE
AELGPAPGGERPAGEGQGEPSPRPKAVTFSPELGPVPPEGLGDYNRAVSKLSAALNSLQR
DMQRLTDQQQRLLAPRQVPVQTRSSILLAEGPPPEEPAARPGLIEIPLSSLEEPAAEDEG
DGSPPGAEDSLEEEASSEGEPRTGLGFFYKDEDKPEDEMAQKRASLLERQQRRAEEARRR
KQWQEAEKEQRREEASRLAQEEVAPSPPAPTAPTASAATPAPAARAPPEEEVGPRRGEFT
RLEYERRAQLKLMDDLDKVLRPRASGSGGPGRGGRRAPRPRSGCCDDSALARSPARGLLG
SRLSKIYSQSTLSLSTVANEAPGSLGVKRPTSRAPSPSGLMSPSRLPGSRERNASSPASV
PEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRD
SSCQFRALYTLSAETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVD
AFTIQGHLWQSKKPTTPKKGSSTPK
Download sequence
Identical sequences W5NUL9
ENSOARP00000001863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]