SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001895 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001895
Domain Number 1 Region: 49-187
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.37e-28
Family 4HBT-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001895   Gene: ENSOARG00000001806   Transcript: ENSOART00000001942
Sequence length 208
Comment pep:known_by_projection chromosome:Oar_v3.1:9:14540439:14544803:-1 gene:ENSOARG00000001806 transcript:ENSOART00000001942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLELLVALLALALAYFALLDGWYLVRVPCAVLRARLLQPRVRDLLAEQSYAGRVLPSDLD
LLLHMNNARYLREADVARIAHLARCGVLEGLRALGARAVLAASCARYRRSLRLFEPFEVR
TRLLGWDDRAFYMEARFISLRDGFVCALLRSRQHVLGTSPERVVQHLCKRRVEPPELPAD
LQHWIAYNEASSQLIRAESGLHDVLKEQ
Download sequence
Identical sequences W5NUQ1
XP_004011667.1.66739 XP_013824531.1.57651 ENSOARP00000001895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]