SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001910 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000001910
Domain Number - Region: 109-172
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.0628
Family NAD-binding domain of HMG-CoA reductase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001910   Gene: ENSOARG00000001822   Transcript: ENSOART00000001957
Sequence length 325
Comment pep:known_by_projection chromosome:Oar_v3.1:22:22476849:22485542:1 gene:ENSOARG00000001822 transcript:ENSOART00000001957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRMEADLSDFNIDAPRWDQCTFLGRVKHFFNITDPRTVLVPERELDWAKVMVEQSRMGT
VPPGTQVEQLFYAKKLYDSAFHPDTGDKMNVIGRMSFQVPGGMIITGFMLQFYRTMPAVI
FWQWVNQSFNALVNYTNRNAASPTSVRQMGVSYITATTTAVATAVGMNMLTKRAPPLVGR
WVPFAAVAAANCVNIPMMRQQELIRGICVKDRNHNEIGHSRRAAAIGITQVVISRITMAA
PGMILLPVLMERLEKLRFVQRIRVLHAPLQVVLSGCFLIFMVPVACGLFPQQCELPVSYL
EPELQDTIKAKYREPVPYVYFNKGL
Download sequence
Identical sequences W5NUR6
ENSOARP00000001910 XP_014958877.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]